Recombinant Carassius auratus Ultraviolet-sensitive opsin

What is the molecular structure of Carassius auratus Ultraviolet-sensitive opsin?

Carassius auratus Ultraviolet-sensitive opsin is a full-length protein consisting of 336 amino acids. The complete amino acid sequence is: MDAWTYQFGNLSKISPFEGPQYHLAPKWAFYLQAAFMGFVFFVGTPLNAIVLFVTMKYKKLRQPLNYILVNISLGGFIFDTFSVSQVFFSALRGYYFFGYTLCAMEAAMGSIAGLVTGWSLAVLAFERYVVICKPFGSFKFGQSQALGAVALTWIIGIGCATPPFWGWSRYIPEGIGTACGPDWYTKNEEYNTESYTYFLLVSCFMMPIMIITFSYSQLLGALRAVAAQQAESASTQKAEKEVSRMVVVMVGSFVVCYGPYAITALYFSYAEDSNKDYRLVAIPSLFSKSSCVYNPLIYAFMNKQFNACIMETVFGKKIDESSEVSSKTETSSVSA . This sequence reveals the characteristic seven transmembrane domain structure typical of G-protein coupled receptors in the opsin family, with specific amino acid residues that contribute to its ultraviolet sensitivity rather than middle or long-wavelength sensitivity.

How does recombinant Ultraviolet-sensitive opsin differ from native opsin?

Recombinant Ultraviolet-sensitive opsin typically includes additional elements not present in the native protein. Most commercially available versions are produced with an N-terminal His-tag to facilitate purification and detection in experimental systems . While the core functional regions of the protein remain intact, researchers should be aware that the tag may influence certain protein-protein interactions or structural characteristics. Expression in E. coli systems also means the protein may lack post-translational modifications that would be present in the native protein extracted from goldfish retinal tissue .

What are the optimal storage conditions for preserving the functionality of recombinant Ultraviolet-sensitive opsin?

The optimal storage conditions for recombinant Ultraviolet-sensitive opsin involve maintaining the protein at -20°C/-80°C upon receipt, with proper aliquoting to prevent repeated freeze-thaw cycles . For working solutions, storage at 4°C is recommended for up to one week . The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . When reconstituting from lyophilized powder, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for long-term storage stability .

What electrophysiological approaches are most effective for studying Ultraviolet-sensitive opsin function?

Intracellular recording techniques using borosilicate microelectrodes filled with 3M KCl (100-500MΩ) have proven effective for studying the functional properties of Ultraviolet-sensitive opsin in isolated retinal preparations . When designing electrophysiological experiments, researchers should implement monochromatic stimuli of equal quanta across a wavelength range of 300-700 nm to properly characterize spectral sensitivity . Assessment of receptive field size and response/intensity functions across different spectral regions is essential for calculating the comprehensive spectral sensitivity profile of UV-sensitive cells . This methodology has successfully identified triphasic bipolar cell types with depolarizing responses in the UV range (300-400 nm) and longer wavelengths (520-700 nm), revealing the neural basis for UV discrimination .

How should researchers design reconstitution protocols for optimal protein activity?

For optimal reconstitution of lyophilized recombinant Ultraviolet-sensitive opsin, researchers should first briefly centrifuge the vial to bring contents to the bottom before opening . Reconstitution should be performed in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . To maintain stability during storage, it is recommended to add glycerol to a final concentration of 5-50%, with 50% being the standard reference concentration . Following reconstitution, the solution should be gently mixed rather than vigorously vortexed to prevent protein denaturation. Aliquoting the reconstituted protein is critical to avoid repeated freeze-thaw cycles that could compromise protein integrity and functional properties .

How does Ultraviolet-sensitive opsin in Carassius auratus compare to similar proteins in other teleost species?

Ultraviolet-sensitive opsins have been identified across various teleost species, showing evolutionary conservation with some species-specific adaptations. In comparative studies involving halibut, herring, and cod, pineal photoreceptors express principal phototransduction molecules, including UV-sensitive opsins, during embryonic development before they appear in retinal photoreceptors . Specifically in halibut, two partial opsin gene sequences (HPO1 and HPO4) show high homology to teleost green and ultraviolet cone opsins (72-83% and 71-83% amino acid identity, respectively) . While the halibut pineal organ appears to have both ultraviolet and green photosensitivity from the embryonic stage, this pattern varies across species. In zebrafish, Atlantic salmon, turbot, and three cichlid species, ultraviolet opsins are primarily expressed in the retina . These comparative differences reflect evolutionary adaptations to diverse aquatic environments and visual requirements.

What is the developmental expression pattern of Ultraviolet-sensitive opsin in teleost fish?

The developmental expression of Ultraviolet-sensitive opsin follows distinct patterns in different teleost species. Immunocytochemical studies have revealed that in Atlantic halibut, herring, and cod, pineal photoreceptors express key phototransduction molecules, including opsins, during embryonic life before they appear in retinal photoreceptors . In halibut specifically, green-like and ultraviolet opsins are expressed in the pineal organ of embryos and subsequently appear in the retina of larvae . In situ hybridization studies demonstrate that while green-like opsin mRNAs are present in both the pineal organ and retina of various teleosts (herring, cod, turbot, haddock, Atlantic salmon, zebrafish, and three cichlid species), ultraviolet opsins show more restricted expression patterns, primarily in the retinas of zebrafish, Atlantic salmon, turbot, and cichlid species . This developmental sequence provides insights into the evolution of visual systems and the adaptation of different teleost species to their specific visual environments.

How do bipolar cells mediate Ultraviolet-sensitive opsin signals in the goldfish retina?

Electrophysiological studies have identified specialized bipolar cells in the goldfish retina that process signals from Ultraviolet-sensitive opsins. A notable discovery is a triphasic bipolar cell type with unique response characteristics, showing depolarizing responses to stimuli in the ultraviolet range (300-400 nm) and longer wavelengths (520-700 nm), with hyperpolarizing responses to blue light (UV+G+R+/B−) . These cells demonstrate spatial opponency in their receptive fields with center/surround organization, corresponding to previously identified biphasic color-coded bipolar cells for wavelengths above 400 nm . The opponency between ultraviolet and violet spectral regions represents a specialized neural mechanism for processing ultraviolet visual information. These bipolar cells likely form a dedicated pathway for transmitting UV-specific information from photoreceptors to higher visual centers, enabling goldfish to discriminate UV wavelengths from other parts of the spectrum.

What are the molecular mechanisms underlying spectral tuning in Ultraviolet-sensitive opsin?

The spectral tuning of Ultraviolet-sensitive opsin in Carassius auratus involves specific amino acid residues that determine its absorption maximum in the UV range. While the search results don't provide the exact mechanisms for goldfish UV opsin, research on UV opsins indicates that key amino acid substitutions in the retinal binding pocket shift the absorption spectrum toward shorter wavelengths. The chromophore binding site and its interaction with specific amino acid residues create an environment that stabilizes the excited state of the retinal chromophore at ultraviolet wavelengths rather than visible wavelengths. This molecular specialization allows UV photons to effectively trigger the conformational change necessary for signal transduction. Comparative analysis of the amino acid sequence of goldfish UV opsin with green-sensitive opsin could reveal the specific residues responsible for spectral tuning to the ultraviolet range in this species.

How does the coexpression of multiple opsin types affect photoreceptor function in goldfish?

Goldfish retinal and pineal cells often coexpress multiple opsin types, which creates complex photosensory capabilities. Research indicates that some cells express both ultraviolet-sensitive and green-sensitive opsins, particularly in the pineal organ . This coexpression likely enables broader spectral sensitivity within individual cells, potentially allowing for more refined color discrimination or adaptation to different lighting conditions. The physiological consequences of this coexpression may include spectrally opponent mechanisms within single cells or the ability to maintain visual function across diverse lighting environments. The relative expression levels of different opsins within the same cell might also be regulated developmentally or in response to environmental factors, providing a mechanism for visual plasticity. Understanding how these different opsin types interact within the same cellular environment is critical for comprehending the full complexity of the goldfish visual system.

What are common challenges in achieving proper folding of recombinant Ultraviolet-sensitive opsin?

Recombinant expression of membrane proteins like Ultraviolet-sensitive opsin presents several technical challenges related to proper folding. When expressed in E. coli systems, these proteins often form inclusion bodies requiring solubilization and refolding procedures . Challenges include achieving the correct disulfide bond formation, proper insertion of the chromophore, and maintaining the seven-transmembrane structure. To address these issues, researchers should consider optimizing expression conditions (temperature, induction time, and inducer concentration), exploring fusion partners that enhance solubility, and implementing gentle solubilization methods. Additionally, stepwise dialysis protocols with gradually decreasing concentrations of denaturants can improve refolding efficiency. For functional studies requiring properly folded protein, mammalian or insect cell expression systems may offer advantages over bacterial systems due to their more sophisticated protein folding machinery.

How can researchers verify the spectral sensitivity of recombinant Ultraviolet-sensitive opsin?

Verification of the spectral sensitivity of recombinant Ultraviolet-sensitive opsin requires a combination of biochemical and spectroscopic approaches. UV-visible absorption spectroscopy of the reconstituted protein with its chromophore (typically 11-cis-retinal) should show an absorption maximum in the ultraviolet range characteristic of UV opsins. Researchers can also employ difference spectroscopy before and after light exposure to confirm photoisomerization of the chromophore. For functional verification, calcium imaging or electrophysiological recordings in expression systems (such as HEK293 cells co-transfected with appropriate G proteins) can demonstrate wavelength-specific responses to UV stimulation . In native tissue contexts, electrophysiological recordings from isolated retinas using monochromatic stimuli of equal quanta across the UV and visible spectrum (300-700 nm) can confirm the expected spectral sensitivity profile . These complementary approaches provide robust verification of the protein's UV sensitivity.

How can Ultraviolet-sensitive opsin be utilized in comparative visual ecology studies?

Recombinant Ultraviolet-sensitive opsin serves as a valuable tool in comparative visual ecology studies exploring how different species adapt to their light environments. Researchers can use the cloned and expressed protein to create antibodies for immunohistochemical localization of UV opsins across species, revealing differences in expression patterns that correlate with ecological niches . Additionally, the amino acid sequence data enables phylogenetic analyses to trace the evolution of UV vision across taxa. In functional studies, comparing the spectral tuning mechanisms between species that inhabit different light environments (e.g., clear shallow water vs. turbid or deep water) can reveal how natural selection shapes visual systems. The goldfish UV opsin can serve as a reference point for understanding how UV vision has evolved in teleost fishes that occupy diverse aquatic environments with varying UV light penetration.

What is the significance of studying Ultraviolet-sensitive opsin in understanding vision evolution in vertebrates?

Studying Ultraviolet-sensitive opsin in goldfish provides critical insights into the evolution of vertebrate vision. The presence of UV sensitivity in teleost fishes like goldfish, which diverged early in vertebrate evolution, suggests that UV vision may be an ancestral trait that was subsequently lost in some lineages (including humans) . Research on goldfish UV opsin helps reconstruct the evolutionary history of vertebrate visual systems and identifies the molecular adaptations that have shaped spectral sensitivity across species. Comparative studies of UV opsin expression in the pineal organ and retina across teleost species reveal diverse evolutionary patterns - some species retain UV sensitivity in both structures, while others restrict it to the retina . These variations reflect adaptations to different ecological niches and visual tasks. Understanding the molecular basis of UV sensitivity in goldfish contributes to broader questions about how visual systems evolve in response to environmental challenges and behavioral needs.

What quality control measures should be implemented when working with recombinant Ultraviolet-sensitive opsin?

Rigorous quality control for recombinant Ultraviolet-sensitive opsin should include several key measures. Purity assessment via SDS-PAGE should confirm protein integrity and absence of significant degradation products, with expected purity greater than 90% . Western blotting using antibodies against the His-tag or the opsin itself can verify protein identity. For functional studies, spectroscopic analysis should confirm the expected absorption characteristics after reconstitution with the chromophore. Researchers should also verify protein folding through circular dichroism spectroscopy to assess secondary structure elements typical of correctly folded seven-transmembrane proteins. Additionally, batch-to-batch consistency should be monitored carefully, as membrane proteins can show variable properties depending on expression and purification conditions. For critical experiments, functional assays such as G-protein activation tests may provide additional confirmation of biological activity prior to experimental use.

How should experimental controls be designed when studying Ultraviolet-sensitive opsin function?

Well-designed experimental controls are essential when studying Ultraviolet-sensitive opsin function. For electrophysiological studies, appropriate controls include testing responses to monochromatic stimuli across a comprehensive wavelength range (300-700 nm) at equal quanta to accurately determine spectral sensitivity . To distinguish UV-specific responses from artifacts, researchers should include spectral regions outside the UV range as internal controls. When investigating opsin expression patterns, appropriate negative controls for in situ hybridization or immunohistochemistry should include sense probes or pre-immune sera, respectively . For comparative studies across species, it's critical to include both closely related species and more distant relatives to distinguish lineage-specific adaptations from convergent evolution. When evaluating the effects of experimental manipulations (like light exposure or chromophore availability), matched control groups maintained under standard conditions are essential for valid interpretation of results.

What emerging technologies might advance our understanding of Ultraviolet-sensitive opsin function?

Several emerging technologies hold promise for advancing our understanding of Ultraviolet-sensitive opsin function. CRISPR-Cas9 gene editing enables precise modification of opsin genes in model organisms, allowing researchers to study the effects of specific amino acid substitutions on spectral tuning in vivo. Cryo-electron microscopy offers the potential to resolve the three-dimensional structure of Ultraviolet-sensitive opsin at near-atomic resolution, providing insights into the molecular basis of UV sensitivity. Advanced optogenetic approaches using Ultraviolet-sensitive opsin as a tool could allow precise control of neural activity in response to UV light, enabling the dissection of UV-specific visual pathways. Single-cell transcriptomics of retinal and pineal cells can reveal the complete complement of genes co-expressed with UV opsins, potentially identifying novel components of the UV phototransduction cascade. These technologies, combined with traditional approaches, will provide a more comprehensive understanding of how Ultraviolet-sensitive opsin contributes to visual function.

What are the potential applications of recombinant Ultraviolet-sensitive opsin beyond basic research?

Beyond basic research, recombinant Ultraviolet-sensitive opsin has several potential applications. As an optogenetic tool, it could provide a spectrally distinct channel for controlling neural activity in combination with other opsins sensitive to visible wavelengths. In biosensor development, the protein could be engineered to detect UV radiation levels in environmental monitoring applications. The study of UV opsin structure and function might inform the design of UV-protective compounds by revealing natural mechanisms for managing high-energy photon absorption. Additionally, understanding UV visual perception through the study of this opsin could contribute to the development of technologies that enhance human perception of UV wavelengths for specific applications. The molecular mechanisms of spectral tuning in UV opsins might also inspire biomimetic materials with novel optical properties or light-sensing capabilities in artificial vision systems.