Recombinant Carboxydothermus hydrogenoformans NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Carboxydothermus hydrogenoformans NADH-quinone Oxidoreductase Subunit A (nuoA)

Recombinant Carboxydothermus hydrogenoformans NADH-quinone oxidoreductase subunit A (nuoA) is a component of the NADH:quinone oxidoreductase complex, also known as Complex I or NDH-1 in bacteria. This enzyme plays a crucial role in the respiratory chain by transferring electrons from NADH to quinones, thereby generating a proton gradient across the cell membrane. The recombinant form of this subunit is produced through genetic engineering techniques, allowing for its expression in host organisms for research or therapeutic purposes.

Biological Function and Structure

NADH-quinone oxidoreductase subunit A (nuoA) is part of a larger enzyme complex that catalyzes the transfer of electrons from NADH to ubiquinone in the bacterial respiratory chain. This process involves several subunits and cofactors, including flavin mononucleotide (FMN) and iron-sulfur clusters, which facilitate electron transfer and proton pumping across the membrane .

SubunitFunctionLocation
NuoAElectron transfer componentInner membrane
NuoBElectron transfer componentInner membrane
NuoCDProton channel, connects soluble and membrane componentsPeripheral arm
NuoE, NuoF, NuoGElectron input part of NADH dehydrogenase ISoluble fragment

Research Findings and Applications

Research on recombinant NADH-quinone oxidoreductase subunits, including those from Carboxydothermus hydrogenoformans, focuses on understanding the structural and functional aspects of these enzymes. These studies are crucial for developing models of electron and proton transport in bacterial respiratory chains, which can inform the design of inhibitors or therapeutic agents targeting bacterial metabolism .

3.2. Inhibitor Studies

Inhibitors like rotenone and piericidin A target specific subunits of NADH-quinone oxidoreductases, disrupting electron transfer between iron-sulfur clusters and quinones. Understanding these interactions is vital for developing targeted antimicrobial agents .

Challenges and Future Directions

Despite advances in understanding NADH-quinone oxidoreductases, challenges remain in elucidating the precise mechanisms of electron transfer and proton pumping. Future research should focus on high-resolution structural studies and functional analyses to address these gaps.

4.1. Therapeutic Potential

The recombinant production of NADH-quinone oxidoreductase subunits could facilitate the development of novel therapeutic strategies, particularly in targeting bacterial pathogens by disrupting their respiratory chains.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; CHY_1425; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Target Names
nuoA
Target Protein Sequence
MLSPKGAILIFFLTGFFLSIIILVLNYLLSPKSKSLIKRETYECGLETIGPTWVQFKGNY FMYALVFVLFDVETIFLYPWAVRFNVLGLFAFVEMVIFIGILVLGLWYAWKEGALEWK
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this organism, the primary electron acceptor is believed to be a menaquinone. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Carboxydothermus hydrogenoformans and why is its nuoA subunit significant?

Carboxydothermus hydrogenoformans is a thermophilic, gram-positive, anaerobic bacterium that can grow utilizing carbon monoxide (CO) as its sole carbon source. This bacterium is chemolithotrophic in nature and produces hydrogen and carbon dioxide as metabolic byproducts . The significance of nuoA, a subunit of NADH-quinone oxidoreductase, relates to its role in the electron transport chain and energy conservation within this unique organism. The nuoA subunit specifically contributes to the membrane-bound complex that couples NADH oxidation to quinone reduction, a key step in cellular respiration under anaerobic conditions. The particular interest in C. hydrogenoformans nuoA stems from the organism's ability to thrive in extreme environments and its unique metabolic capabilities related to hydrogen production, which have potential biotechnological applications.

How does nuoA function within the larger NADH-quinone oxidoreductase complex?

The nuoA subunit functions as one component of the multisubunit NADH-quinone oxidoreductase (NQOR) complex. In general, NQOR catalyzes the reduction of quinones, azo dyes, and other electron acceptors by NADPH or NADH . Within this context, nuoA is typically a membrane-associated subunit that helps anchor the complex to the cytoplasmic membrane. The NQOR complex in C. hydrogenoformans likely interfaces with the organism's unique carbon monoxide metabolism. Unlike typical NQOR complexes that accept electrons directly from NADH, the C. hydrogenoformans system may receive electrons derived from CO oxidation. The enzyme complex contains both hydrophilic and hydrophobic polypeptide subunits, with nuoA being among the hydrophobic components that are essential for proper complex assembly and function . The membrane association of nuoA positions it strategically to participate in proton translocation across the membrane, contributing to the chemiosmotic gradient that drives ATP synthesis.

What genomic features characterize the nuoA gene in C. hydrogenoformans?

The nuoA gene is part of the complete genome of C. hydrogenoformans Z-2901, which has been sequenced and characterized as a circular chromosome of approximately 2.4 Mbp . The genome contains approximately 2,645 protein-coding genes, with about 69.82% of these genes having presumed functions . While specific details about the nuoA gene are not directly provided in the search results, it likely resides within operons related to energy metabolism. The genome sequence analysis of C. hydrogenoformans revealed various genes involved in carbon monoxide utilization and hydrogen production, and the nuoA gene would be functionally associated with these pathways. In bacterial systems, nuoA genes are typically organized in operons with other nuo genes (nuoB, nuoC, etc.) that collectively encode the different subunits of the NADH-quinone oxidoreductase complex. The thermophilic nature of C. hydrogenoformans suggests that its nuoA gene and resulting protein would contain features that contribute to thermal stability.

What expression systems are most effective for producing recombinant C. hydrogenoformans nuoA?

When designing expression systems for recombinant C. hydrogenoformans nuoA, researchers must consider several factors related to the thermophilic origin and membrane-associated nature of the protein. For thermophilic proteins, E. coli BL21(DE3) with temperature-inducible promoters can be effective, though expression at lower temperatures (15-25°C) often improves proper folding despite being counterintuitive for thermophilic proteins. Alternatively, homologous expression in thermophilic hosts like Thermus thermophilus may preserve native folding and activity. The membrane-associated nature of nuoA presents additional challenges, potentially requiring specialized approaches such as fusion with solubility-enhancing tags (MBP, SUMO, or Trx) or co-expression with chaperones (GroEL/GroES) to prevent aggregation.
For heterologous expression in E. coli, vectors containing T7 or tac promoters with tight regulation capabilities are recommended, as premature expression could be toxic. A methodological approach would include testing multiple conditions, including:

  • Induction at varying temperatures (15-37°C)

  • Multiple IPTG concentrations (0.1-1.0 mM)

  • Various media formulations (LB, TB, autoinduction media)

  • Co-expression with molecular chaperones
    Given the anaerobic metabolism of C. hydrogenoformans, expression under microaerobic or anaerobic conditions might also improve proper folding and activity of recombinant nuoA .

What purification strategies overcome the challenges associated with membrane-associated nuoA?

Purification of recombinant nuoA presents significant challenges due to its hydrophobic nature as a membrane protein. A methodical approach involves a multi-step strategy beginning with careful membrane solubilization. The use of mild detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin at concentrations just above their critical micelle concentration (CMC) effectively solubilizes membrane proteins while maintaining native structure. For thermophilic proteins like those from C. hydrogenoformans, higher temperatures during solubilization may increase efficiency while reducing the required detergent concentration.
The purification workflow typically includes:

  • Cell disruption by sonication or French press in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Detergent solubilization of membrane proteins

  • Immobilized metal affinity chromatography (IMAC) using polyhistidine-tagged nuoA

  • Size exclusion chromatography to remove aggregates and contaminants
    When working with subunits of larger complexes like nuoA, researchers should consider whether isolation of the intact NADH-quinone oxidoreductase complex might be more biologically relevant than purifying individual subunits. For functional studies, reconstitution into liposomes or nanodiscs may be necessary to provide the lipid environment required for proper structure and function. Temperature stability tests at various stages of purification are essential to monitor the thermal stability characteristic of proteins from thermophilic organisms like C. hydrogenoformans .

How can researchers assess the functional activity of recombinant nuoA?

Assessing the functional activity of recombinant nuoA presents unique challenges as it normally functions as part of the larger NADH-quinone oxidoreductase complex. A comprehensive approach involves both direct and indirect activity measurements. For direct assessment, researchers can monitor quinone reduction by tracking changes in absorbance of quinone analogs such as ubiquinone-1 or decylubiquinone at 340 nm in the presence of NADH. This assay would require either co-expression of the full complex or reconstitution of nuoA with other subunits.
Indirect methods include:

  • Membrane binding assays to confirm proper subcellular localization

  • Protein-protein interaction studies with other subunits using techniques such as co-immunoprecipitation or cross-linking

  • Thermal stability analysis to confirm proper folding of the thermophilic protein

  • Proteoliposome reconstitution followed by NADH oxidation measurements
    When studying nuoA in the context of C. hydrogenoformans metabolism, researchers should consider the organism's unique carbon monoxide utilization pathway. This may involve designing assays that couple electron transfer from carbon monoxide dehydrogenase to the NADH-quinone oxidoreductase complex, particularly in anaerobic conditions at elevated temperatures that mimic the natural environment of this thermophilic bacterium . Activity measurements should be performed at temperatures ranging from 30°C to 70°C to determine the optimal temperature for enzyme function, which is expected to be significantly higher than mesophilic homologs due to C. hydrogenoformans' thermophilic nature.

How do researchers interpret subunit functional studies in the context of the complete NADH-quinone oxidoreductase complex?

  • Compare kinetic parameters (Km, kcat) of isolated nuoA versus the complete complex to identify cooperative effects

  • Evaluate whether nuoA alone shows any partial activity or requires specific partner subunits

  • Assess how temperature affects the assembly and stability of nuoA with other subunits, especially relevant for thermophilic C. hydrogenoformans

  • Consider how the unique carbon monoxide metabolism of C. hydrogenoformans might influence complex assembly and function
    A heterodimer approach, similar to that used in previous NQOR studies, can be particularly valuable. This involves expressing wild-type/mutant heterodimers and analyzing their functional parameters. Such experiments have revealed that "subunits of NQOR function independently with two-electron acceptors, but dependently with a four-electron acceptor" . When interpreting results for C. hydrogenoformans nuoA, researchers should consider how the thermophilic nature of the organism influences protein-protein interactions within the complex and how these might differ from mesophilic homologs.

What bioinformatic approaches are most useful for analyzing nuoA sequence and structural predictions?

Comprehensive bioinformatic analysis of nuoA requires multiple computational approaches to predict sequence features, structural elements, and evolutionary relationships. For primary sequence analysis, tools like BLAST and HMMER can identify homologs across species, with particular attention to other thermophilic and hydrogenogenic bacteria. Multiple sequence alignments using MUSCLE or CLUSTALW help identify conserved residues that may be functionally critical. For a protein from a thermophilic organism like C. hydrogenoformans, researchers should specifically look for amino acid compositions associated with thermostability, such as increased charged residues forming salt bridges and reduced thermolabile residues.
For structural predictions:

  • Transmembrane topology prediction using TMHMM or TOPCONS to identify membrane-spanning regions characteristic of nuoA

  • Homology modeling based on crystallized NADH-quinone oxidoreductase complexes from other species

  • Molecular dynamics simulations at elevated temperatures (60-70°C) to assess thermostability

  • Protein-protein docking with other subunits to predict interface regions
    Researchers should also leverage the complete genome sequence of C. hydrogenoformans Z-2901 to examine the genomic context of nuoA, including operonic structure and potential co-regulation with other genes . Comparative genomics between C. hydrogenoformans and other hydrogenogenic bacteria like Rhodospirillum rubrum can provide insights into functional adaptations of nuoA in carbon monoxide metabolism . Given that C. hydrogenoformans has multiple carbon monoxide dehydrogenase complexes (CODH I-V), analysis should include potential interactions between these systems and the NADH-quinone oxidoreductase complex containing nuoA .

How does the thermophilic nature of C. hydrogenoformans influence the interpretation of nuoA experimental results?

The thermophilic nature of C. hydrogenoformans significantly impacts how researchers should interpret experimental results for nuoA. When analyzing biochemical data, temperature dependence must be carefully considered across multiple parameters. Enzymatic activity typically shows a bell-shaped curve with temperature, but thermophilic enzymes like those from C. hydrogenoformans exhibit optimal activity at much higher temperatures (often 60-80°C) compared to mesophilic homologs. This necessitates conducting assays across a wide temperature range to properly characterize the enzyme's performance envelope.
Key considerations when interpreting results include:

  • Protein stability assessments should include thermal denaturation profiles using techniques like differential scanning calorimetry or thermal shift assays

  • Kinetic parameters (Km, kcat) should be determined at multiple temperatures to establish Arrhenius plots and activation energies

  • Structural analyses must account for potential conformational changes at elevated temperatures

  • Expression and purification yields may be misleadingly low at standard laboratory temperatures (25-37°C)
    The anaerobic lifestyle of C. hydrogenoformans adds another dimension to data interpretation. Results obtained under aerobic conditions may not reflect native activity, as oxygen exposure could damage sensitive redox centers or cause structural perturbations. Comparative analysis with data from mesophilic NADH-quinone oxidoreductases can highlight thermoadaptive features unique to C. hydrogenoformans nuoA . When analyzing protein-protein interactions involving nuoA, researchers should note that high-temperature adaptations often include more rigid protein cores but more flexible surface loops, which might influence complex assembly differently than in mesophilic systems.

How can nuoA be engineered to enhance electron transfer efficiency for biotechnological applications?

Engineering nuoA for enhanced electron transfer efficiency requires sophisticated protein design strategies that target specific structural and functional elements. A rational engineering approach begins with identifying rate-limiting steps in electron transfer pathways through kinetic analyses of the wild-type protein. For C. hydrogenoformans nuoA, which functions in a thermophilic environment, modifications should preserve or enhance thermostability while improving catalytic efficiency. Site-directed mutagenesis of conserved residues at the quinone-binding site can potentially increase binding affinity or accelerate electron transfer rates. Additionally, modifying residues that participate in subunit interactions may enhance complex assembly and stability.
Potential engineering strategies include:

  • Introduction of additional Fe-S clusters or optimization of existing electron transfer pathways

  • Modification of surface charges to improve electron transfer partner interactions

  • Engineering of substrate channels to enhance quinone accessibility

  • Creation of chimeric proteins incorporating efficient domains from other thermophilic oxidoreductases
    A particularly promising approach involves integrating nuoA into artificial electron transfer systems for bioelectrocatalysis. Researchers have demonstrated that oxidoreductases can catalyze electron transfer reactions through reduction or oxidation of substrates, with applications in biosensors and biofuel cells . For C. hydrogenoformans nuoA, this could involve engineering direct electrical connections between the recombinant protein and electrode surfaces, potentially utilizing the organism's natural ability to perform extracellular electron transfer. Successful engineering would require iterative rounds of design, expression, and functional testing, with special attention to preserving the thermostability that makes this enzyme particularly valuable for industrial applications.

What is the relationship between nuoA and the carbon monoxide dehydrogenase complexes in C. hydrogenoformans?

The relationship between nuoA and the carbon monoxide dehydrogenase (CODH) complexes in C. hydrogenoformans represents a sophisticated metabolic integration between energy generation and electron transport. Genomic analysis has revealed that C. hydrogenoformans possesses five distinct CODH complexes (CODH I-V), each with specialized functions: CODH I for energy conservation, CODH III for carbon fixation, CODH IV for oxidative stress response, and the remaining two for generating NADPH under anaerobic conditions . The nuoA subunit, as part of the NADH-quinone oxidoreductase complex, likely interfaces with this carbon monoxide utilization system by participating in the electron transport chain that ultimately supports energy conservation.
The probable metabolic connections include:

  • Electrons derived from CO oxidation by CODH I may feed into the membrane-bound respiratory chain involving the NADH-quinone oxidoreductase complex

  • The proton gradient generated by this respiratory chain drives ATP synthesis

  • NADH produced through metabolic processes may be re-oxidized by the complex containing nuoA
    This relationship is particularly significant in the context of hydrogen production, where C. hydrogenoformans employs a hydrogenase to produce H₂ using electrons derived from CO oxidation. Elementary flux mode analysis of the acetyl-CoA pathway in C. hydrogenoformans has demonstrated theoretical hydrogen yields of up to 47.62 mmol/gCDW/h for 1 mole of carbon monoxide uptake . Understanding how nuoA contributes to electron flow within this metabolic network could provide insights for optimizing hydrogen production through metabolic engineering approaches. Advanced studies might employ isotope labeling and metabolic flux analysis to trace electron flow from CO through the respiratory chain involving nuoA.

How do the structural adaptations of C. hydrogenoformans nuoA contribute to function under extreme conditions?

The structural adaptations of C. hydrogenoformans nuoA for function under extreme conditions (high temperature, anaerobic environment) likely involve multiple sophisticated molecular strategies. Proteins from thermophilic organisms typically display increased numbers of salt bridges, enhanced hydrophobic interactions in the protein core, higher proportion of charged amino acids, and reduced thermolabile residues (asparagine, glutamine) compared to mesophilic homologs. For nuoA specifically, these adaptations would be crucial for maintaining structural integrity at the elevated temperatures (around 70°C) where C. hydrogenoformans thrives.
Key structural adaptations may include:

  • Specialized transmembrane domains with hydrophobic matching to maintain membrane integrity at high temperatures

  • Modified quinone-binding sites that remain functional under thermal stress

  • Thermostable interfaces with other subunits of the NADH-quinone oxidoreductase complex

  • Potential disulfide bonds that contribute to protein stability
    The anaerobic lifestyle of C. hydrogenoformans suggests that nuoA would also have adaptations for function in low-oxygen environments, potentially including redox-sensitive residues and oxygen-independent folding pathways. Comparative analysis with homologous proteins from mesophilic organisms could highlight these thermoadaptive features. Advanced structural studies using cryo-electron microscopy or X-ray crystallography would provide definitive insights into these adaptations, though the membrane-associated nature of nuoA presents technical challenges for structural determination . Understanding these adaptations has implications beyond basic science, potentially informing the design of thermostable enzymes for biotechnological applications in biofuel production and bioelectrocatalysis.

What are the optimal conditions for assaying recombinant C. hydrogenoformans nuoA activity?

Establishing optimal assay conditions for recombinant C. hydrogenoformans nuoA requires careful consideration of the organism's thermophilic and anaerobic nature. The temperature range for assays should center around 65-75°C, reflecting the optimal growth temperature of C. hydrogenoformans. Buffer systems must maintain stability at these elevated temperatures, with HEPES or phosphate buffers at pH 7.0-7.5 being suitable choices. The addition of glycerol (5-10%) can enhance protein stability during thermal incubation. Given the anaerobic lifestyle of the source organism, assays should ideally be conducted under strict anaerobic conditions in an anaerobic chamber or using sealed cuvettes with oxygen-scavenging systems.
A comprehensive activity assay protocol would include:

  • Pre-warming all reagents and equipment to the target temperature

  • Buffer composition: 50 mM HEPES or phosphate buffer (pH 7.2), 100-150 mM NaCl, 5% glycerol

  • Electron donors: NADH (primary) or NADPH (secondary) at 0.1-0.5 mM

  • Electron acceptors: Various quinones (ubiquinone, menaquinone) at 50-100 μM

  • Monitoring absorbance changes at 340 nm (NADH oxidation) and at appropriate wavelengths for quinone reduction
    For membrane-associated proteins like nuoA, incorporation into liposomes or detergent micelles is often necessary to provide an appropriate hydrophobic environment. The choice of detergent is critical, with mild non-ionic detergents like DDM or Triton X-100 at concentrations just above their CMC being preferable. When assaying nuoA as part of the complete NADH-quinone oxidoreductase complex, researchers should consider the potential cooperative effects between subunits and may need to co-express or reconstitute the entire complex for meaningful activity measurements .

What techniques are most effective for studying protein-protein interactions involving nuoA?

Studying protein-protein interactions involving the membrane-associated nuoA subunit requires specialized techniques that accommodate both the hydrophobic nature of the protein and the complexity of multisubunit assemblies. Crosslinking approaches using chemical crosslinkers like DSS or photoactivatable reagents can capture transient interactions between nuoA and other subunits of the NADH-quinone oxidoreductase complex. After crosslinking, mass spectrometry analysis can identify interaction partners and specific contact residues. For thermophilic proteins like those from C. hydrogenoformans, crosslinking should be performed at elevated temperatures to capture physiologically relevant interactions.
Advanced techniques for studying these interactions include:

  • Blue native PAGE to analyze intact complexes and subcomplexes

  • Surface plasmon resonance (SPR) using detergent-solubilized proteins or nanodiscs

  • Förster resonance energy transfer (FRET) using fluorescently labeled subunits

  • Cryo-electron microscopy to visualize the assembled complex architecture
    The heterodimer approach, as demonstrated in previous studies of NAD(P)H:quinone oxidoreductase, provides valuable insights into subunit interactions. This involves co-expressing wild-type and mutant forms of interacting proteins and analyzing the resulting heterodimers . To adapt this for nuoA, researchers could create tagged versions of the protein with strategic mutations, allowing purification and analysis of specific subcomplexes. When interpreting interaction data, researchers should consider the possibility that interactions may be different at the elevated temperatures where C. hydrogenoformans normally thrives, necessitating temperature-controlled experimental conditions whenever possible.

How can researchers effectively integrate structural and functional data for a comprehensive understanding of nuoA?

Effective integration of structural and functional data for nuoA requires a multidisciplinary approach that connects molecular structure to biochemical activity and physiological role. Researchers should begin by mapping functional data onto structural models, identifying how specific structural elements contribute to observed activities. For instance, site-directed mutagenesis results can be interpreted in the context of homology models or crystal structures to understand how specific residues contribute to quinone binding, subunit interactions, or thermostability. Advanced computational approaches like molecular dynamics simulations at elevated temperatures can bridge structural and functional insights by predicting how thermal motion influences protein dynamics and activity.
A comprehensive integration strategy includes:

What opportunities exist for applying C. hydrogenoformans nuoA in bioelectrochemical systems?

The application of C. hydrogenoformans nuoA in bioelectrochemical systems represents an exciting frontier in renewable energy research. The thermostable nature of this protein, derived from an organism that thrives at temperatures around 70°C, offers significant advantages for industrial applications where thermal stability translates to extended operational lifetimes and resistance to deactivation. As part of the NADH-quinone oxidoreductase complex, nuoA participates in electron transfer processes that could potentially be harnessed for bioelectrocatalysis in microbial fuel cells or biosensors. The thermophilic origin of this protein may allow operation at elevated temperatures, which can enhance reaction rates and reduce cooling costs in industrial settings.
Potential applications include:

  • Development of thermostable bioelectrodes for high-temperature microbial fuel cells

  • Creation of biosensors capable of functioning in harsh industrial environments

  • Integration into biohydrogen production systems that leverage C. hydrogenoformans' natural hydrogen-producing capacity

  • Engineering of artificial electron transport chains for biocatalytic synthesis
    Research in bioelectrocatalysis has demonstrated that oxidoreductases can catalyze electron transfer reactions through reduction or oxidation of substrates, with applications extending to biosensors and biofuel cells . For C. hydrogenoformans nuoA, the connection to carbon monoxide metabolism provides an additional avenue for application in CO-utilizing bioelectrochemical systems. By engineering recombinant nuoA to interface with electrodes, researchers could potentially develop systems that convert CO directly to electricity or valuable reduced products, contributing to both pollution mitigation and renewable energy generation.

How might nuoA engineering contribute to enhanced hydrogen production in biotechnological applications?

Engineering nuoA to enhance hydrogen production represents a strategic approach to improving the efficiency of biological hydrogen generation systems. C. hydrogenoformans naturally produces hydrogen from carbon monoxide, with theoretical yields reaching 47.62 mmol/gCDW/h for 1 mole of carbon monoxide uptake, approximately twice the experimentally observed yields . This gap between theoretical and observed yields suggests significant room for improvement through protein engineering and metabolic optimization. As part of the electron transport chain, nuoA could be engineered to direct electron flow more efficiently toward hydrogenase enzymes rather than competing metabolic pathways.
Potential engineering strategies include:

  • Modifying nuoA to enhance its interaction with electron carriers that supply reducing equivalents to hydrogenases

  • Engineering the quinone-binding site to favor specific quinone types that promote hydrogen production

  • Creating fusion proteins that directly couple nuoA to hydrogenase components

  • Implementing regulatory modifications that increase nuoA expression under hydrogen-producing conditions
    The elementary flux mode analysis of the acetyl-CoA pathway in C. hydrogenoformans provides valuable insights for this engineering effort. The study demonstrated that in silico gene knockout of pyk, pykC, and mdh genes allowed maximum theoretical hydrogen yield, suggesting that redirecting electron flow away from competing pathways is key to enhancing hydrogen production . Engineering nuoA to complement these metabolic modifications could create synergistic effects, potentially approaching the theoretical maximum yield. This approach aligns with global interests in hydrogen as a clean energy carrier, offering a biological route to hydrogen production that utilizes waste carbon monoxide as a feedstock.

What insights might comparative studies between C. hydrogenoformans nuoA and homologs from other extremophiles provide?

Comparative studies between C. hydrogenoformans nuoA and homologs from other extremophiles would yield valuable insights into convergent and divergent evolutionary strategies for protein adaptation to extreme environments. Such studies could reveal common molecular mechanisms of thermostability by comparing nuoA from C. hydrogenoformans (a thermophile) with homologs from hyperthermophiles like Aquifex aeolicus or Pyrococcus furiosus. Alternatively, comparing with homologs from psychrophilic organisms would highlight contrasting adaptation strategies across temperature extremes. These comparisons should focus on amino acid composition, patterns of surface charge distribution, internal packing arrangements, and flexibility of critical regions.
Key research directions include:

  • Comparative genomics to identify selection pressures on nuoA across diverse extremophiles

  • Structural comparisons to identify conserved thermostability determinants

  • Heterologous expression and chimeric protein construction to test functional elements

  • Molecular dynamics simulations to compare protein dynamics across temperature ranges
    The unique carbon monoxide metabolism of C. hydrogenoformans provides an additional dimension for comparative studies. Analyzing how nuoA interfaces with carbon monoxide dehydrogenase complexes in this organism compared to interaction patterns in other metabolic contexts could reveal adaptations specific to carbon monoxide utilization . A particularly interesting comparison would be with CooA from Rhodospirillum rubrum, another CO-utilizing organism that exhibits different regulatory mechanisms for CO metabolism . These comparative studies would not only advance fundamental understanding of protein adaptation but could also inform the design of engineered proteins with enhanced stability and functionality for biotechnological applications in extreme conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.