Recombinant Carboxydothermus hydrogenoformans Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Carboxydothermus hydrogenoformans Sec-independent Protein Translocase Protein TatC (tatC)

Recombinant Carboxydothermus hydrogenoformans Sec-independent protein translocase protein TatC (tatC) is a heterotetrameric membrane-bound transporter essential for the secretion of folded proteins in thermophilic bacteria. Unlike the Sec-dependent pathway, which transports unfolded proteins, TatC facilitates the export of pre-folded proteins, such as redox enzymes, without requiring a proton gradient. This protein has gained attention in biotechnological applications due to its thermophilic stability and substrate specificity. Below is a detailed analysis of its molecular characteristics, production parameters, and functional roles, synthesized from peer-reviewed studies and commercial product specifications.

Thermal and Biochemical Stability

  • Optimal Storage: -20°C or -80°C in Tris-based buffer with 50% glycerol .

  • Thermal Resistance: Retains activity after short-term exposure to elevated temperatures (e.g., 70°C for 1 hour in related transketolases ).

Recombinant Expression Systems

Host SystemPurityApplication
Cell-Free Expression≥85% (SDS-PAGE) High-throughput protein studies
E. coli or Yeast≥85% (SDS-PAGE) Structural and functional assays

Recombinant TatC is typically expressed in heterologous systems (e.g., E. coli) or via cell-free synthesis, enabling scalable production for biochemical assays. The protein is purified using affinity chromatography (e.g., nickel columns for His-tagged variants) and size-exclusion chromatography .

Key Challenges in Production

  • Low Yield: Due to thermophilic origins, recombinant expression in mesophilic hosts may require chaperones or refolding protocols.

  • Stability: Repeated freezing/thawing cycles reduce activity; working aliquots are stored at 4°C for up to 1 week .

Functional Role in Protein Secretion

TatC facilitates the export of fully folded proteins, including:

  1. Redox Enzymes: Such as CO dehydrogenases and hydrogenases in C. hydrogenoformans .

  2. Metalloproteins: Requiring proper cofactor assembly before secretion.

  3. Chaperones: Assisting in the folding of extracellular proteins.

The Tat pathway is critical for thermophilic bacteria, where protein folding under high temperatures demands robust secretion mechanisms.

Biotechnological Potential

  • Thermophilic Biocatalysis: TatC’s stability at high temperatures enables its use in industrial processes (e.g., biofuel production) .

  • Protein Engineering: Structural studies of TatC variants (e.g., from Aquifex aeolicus) guide the design of efficient secretion systems in synthetic biology .

Comparative Analysis with Other TatC Homologs

OrganismHost SystemPurityKey Application
C. hydrogenoformansCell-free≥85% CO metabolism studies
Helicobacter pyloriE. coli/Yeast≥85% Pathogen secretion mechanisms
Aquifex aeolicusCell-free≥85% Structural biology models

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
tatC; CHY_0863; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Target Names
tatC
Target Protein Sequence
MEDKPMTLFEHLEALRKVIIISVIAIVIGSIIAYNYVDYFLNILLQPVTALKMKLVFINV TEAFMTKLKIAIILGIILASPIILWQIWSFVAPGLKPAERKFILRMIPVIIILFVAGIVF AFFTVFQIATRFLLQFGGDIMSPMITIGKYISFALNFLIPFGLVFELPVVVYILAKLNII SHEFLVKNRKYALLVVFILAAALTPGPDVISQLLMAAPLLILYEVSIFIAKFIKPKEFSG ERK
Uniprot No.

Target Background

Function
A component of the twin-arginine translocation (Tat) system, this protein transports large, folded proteins across membranes. These proteins are characterized by a twin-arginine motif within their signal peptide.
Database Links
Protein Families
TatC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Carboxydothermus hydrogenoformans and why is it significant for research?

Carboxydothermus hydrogenoformans is an extremely thermophilic, Gram-positive bacterium isolated from a hot spring in Kunashir Island, Russia. It has gained significant research attention for three primary reasons: it grows at remarkably high temperatures (optimally at 78°C), it metabolizes carbon monoxide (CO) as its primary carbon and energy source, and it produces hydrogen gas as a metabolic byproduct. This organism belongs to the Firmicutes Phylum (low GC Gram-positives) and represents an important model for studying hydrogenogens - bacteria that grow anaerobically using CO as their sole carbon source and water as an electron acceptor .

What is the function of Sec-independent protein translocase protein TatC in C. hydrogenoformans?

The Sec-independent protein translocase protein TatC (tatC) is a critical component of the Twin-Arginine Translocation (Tat) pathway in C. hydrogenoformans. This pathway is responsible for transporting folded proteins across the cytoplasmic membrane, in contrast to the Sec pathway that transports unfolded proteins. TatC functions as the core component of the Tat translocase complex, recognizing the twin-arginine signal peptide of substrate proteins and facilitating their translocation.

In extremophiles like C. hydrogenoformans, the Tat pathway is particularly important for the export of proteins that must fold in the cytoplasm before translocation, often because they incorporate cofactors or form complexes that cannot be assembled in the periplasm. The protein's role is especially significant in organisms living in extreme environments where protein stability and proper folding are challenged by high temperatures .

What are the optimal storage conditions for recombinant C. hydrogenoformans TatC protein?

The optimal storage conditions for recombinant C. hydrogenoformans TatC protein depend on the formulation. Based on standard protocols for similar recombinant proteins, the following storage guidelines are recommended:

FormulationStorage TemperatureShelf LifeSpecial Considerations
Liquid form-20°C/-80°C6 monthsAvoid repeated freeze-thaw cycles
Lyophilized form-20°C/-80°C12 monthsReconstitute immediately before use

The shelf life of the protein is influenced by multiple factors including storage state, buffer ingredients, and the intrinsic stability of the protein itself. For maximum stability, aliquoting the protein before freezing is recommended to avoid repeated freeze-thaw cycles, which can lead to protein degradation and loss of activity .

How should I design experiments to study the function of recombinant TatC in protein translocation systems?

Designing experiments to study recombinant TatC function requires a systematic approach with appropriate controls. Consider the following methodological framework:

  • Define clear research questions and hypotheses: Formulate specific questions about TatC's role in protein translocation under various conditions (e.g., temperature, pH, substrate concentration) .

  • Identify independent and dependent variables: Your independent variables might include temperature, pH, presence of specific substrates, or mutations in TatC. Dependent variables could include translocation efficiency, protein-protein interactions, or substrate binding capacity .

  • Establish experimental and control groups: Use wild-type TatC as a control against mutant variants, or compare TatC activity in native versus heterologous expression systems .

  • Translocation assays: Implement in vitro translocation assays using purified components (recombinant TatC, TatA, TatB) and fluorescently labeled substrate proteins. Measure translocation efficiency through fluorescence detection or immunoblotting .

  • Site-directed mutagenesis: Create specific mutations in the conserved regions of TatC to identify critical residues for substrate recognition or protein-protein interactions .

  • Protein-protein interaction studies: Use techniques such as co-immunoprecipitation, bacterial two-hybrid systems, or surface plasmon resonance to investigate interactions between TatC and other components of the translocation machinery .

  • Comparative analysis: Compare C. hydrogenoformans TatC with homologs from mesophilic organisms to investigate temperature-dependent functionality differences .

  • Randomization: Ensure proper randomization in your experimental design to minimize bias and control for extraneous variables .

What approaches should be used when data contradicts hypotheses about TatC function?

When facing data that contradicts your initial hypotheses about TatC function, adopt a systematic approach:

  • Thoroughly examine the data: Carefully analyze all results, identifying specific discrepancies between expected outcomes and actual findings. Pay special attention to outliers that might indicate interesting biological phenomena rather than experimental errors .

  • Evaluate experimental design and execution: Review your methodology for potential issues in experimental design, reagent quality, or execution that might explain unexpected results. Consider if the recombinant protein's purity (>85% by SDS-PAGE) could impact your findings .

  • Consider alternative hypotheses: Based on contradictory data, formulate alternative explanations for TatC function. For instance, if TatC does not behave as expected at high temperatures, consider whether it might have evolved specialized thermostable domains or co-factors in C. hydrogenoformans .

  • Refine variables and controls: Implement additional controls and refine your variables to test newly developed hypotheses. This might involve testing TatC function across a broader temperature range or examining the influence of specific buffer components .

  • Consult literature on related proteins: Investigate whether similar contradictions have been reported for TatC from other extremophiles. The lateral gene transfer observed in C. hydrogenoformans for other proteins (like cooF and cooS) suggests similar patterns might exist for translocation machinery components .

  • Validate findings through alternative methods: Confirm unexpected results using different experimental approaches. For example, if biochemical assays show surprising results, validate with structural or computational methods .

  • Embrace the contradiction: Sometimes, contradictory data leads to scientific breakthroughs. The unexpected finding that C. hydrogenoformans is not an obligate CO autotroph demonstrates how contradictions can advance understanding .

How might the extreme thermophilic nature of C. hydrogenoformans affect the structure and function of its TatC protein compared to mesophilic homologs?

The extreme thermophilic nature of C. hydrogenoformans, with optimal growth at 78°C, likely imparts distinct structural and functional adaptations to its TatC protein compared to mesophilic homologs:

Structural adaptations: TatC from C. hydrogenoformans likely exhibits several thermostability-enhancing features:

  • Increased number of salt bridges and hydrogen bonds to stabilize tertiary structure

  • Higher proportion of charged residues on the protein surface

  • Reduced number of thermolabile residues (Asn, Gln, Cys, Met)

  • Potentially more compact structure with shorter loops

  • Increased hydrophobic interactions in the protein core

Functional implications: These structural adaptations may result in:

  • Different substrate recognition mechanisms that maintain specificity at high temperatures

  • Modified protein-protein interaction interfaces with other Tat components

  • Potentially altered kinetics of the translocation process

  • Enhanced stability of the TatC-substrate complex at elevated temperatures

Experimental approaches to investigate these differences:

  • Comparative structural analysis through X-ray crystallography or cryo-electron microscopy

  • Thermal stability assays comparing denaturation profiles of TatC proteins from thermophilic versus mesophilic organisms

  • Molecular dynamics simulations to identify thermostability-conferring structural elements

  • Chimeric protein construction combining domains from thermophilic and mesophilic TatC homologs to identify critical regions for thermostability

Understanding these adaptations could provide insights not only into protein translocation at high temperatures but also into general principles of protein thermostability that could be applied to protein engineering .

What methods can be used to investigate potential lateral gene transfer of the tatC gene in C. hydrogenoformans?

Investigating potential lateral gene transfer (LGT) of the tatC gene in C. hydrogenoformans requires a multi-faceted approach, drawing on methods that have successfully identified LGT in other genes of this organism, such as cooF and cooS :

  • Comparative codon usage analysis: Analyze the codon usage pattern of tatC and compare it with the genomic codon usage of C. hydrogenoformans. Significant deviations might indicate foreign origin, as observed with the cooF gene which shows an archaeal-like Arg codon usage pattern dominated by AGA and AGG .

  • Phylogenetic incongruence analysis: Construct phylogenetic trees based on tatC sequences and compare them with species trees based on conserved markers (e.g., 16S rRNA). Topological discrepancies between gene and species trees may indicate LGT events .

  • Comparative genomic context analysis: Examine the genomic region surrounding tatC for signs of genomic islands, such as atypical GC content, presence of mobile genetic elements, or disruption of synteny compared to related species .

  • Sequence similarity network analysis: Create sequence similarity networks to visualize relationships between tatC sequences across diverse organisms, potentially revealing unexpected similarities suggestive of LGT .

  • Molecular clock analysis: Compare evolutionary rates of tatC with housekeeping genes to identify accelerated or decelerated evolution that might result from LGT .

Analysis MethodKey ParametersExpected Indications of LGTTechnical Considerations
Codon usage analysisRelative synonymous codon usage (RSCU)Significant deviation from genomic averageRequires sufficient coding sequences for comparison
Phylogenetic analysisBootstrap support, tree topologyClustering with distant organismsMultiple sequence alignment quality is critical
GC content analysisLocal GC percentageAtypical GC content in tatC regionNeed to account for natural GC content variation
Synteny analysisGene order conservationDisruption of conserved gene orderRequires closely related reference genomes

Given the evidence of LGT in C. hydrogenoformans for carbon monoxide metabolism genes (cooF and cooS showing similarity to genes from the archaeon Archaeoglobus fulgidus and the bacterium Rhodospirillum rubrum), investigating whether similar patterns exist for tatC could reveal important insights about the evolution of protein translocation systems in extremophiles .

What are the optimal protocols for expressing and purifying recombinant C. hydrogenoformans TatC?

Expressing and purifying recombinant C. hydrogenoformans TatC presents unique challenges due to its thermophilic origin and membrane protein nature. Based on established methodologies for similar proteins, the following optimized protocol is recommended:

Expression system selection:

  • Recommended primary system: Yeast expression systems (such as Pichia pastoris) provide appropriate eukaryotic processing machinery and have proven successful for this protein

  • Alternative systems: E. coli with specialized strains (C41, C43) designed for membrane protein expression

  • Considerations: For functional studies, bacterial systems may be preferable; for structural studies requiring extensive post-translational modifications, yeast or insect cell systems may be optimal

Expression optimization:

  • Use codon-optimized synthetic gene constructs for the expression host

  • Employ strong inducible promoters (e.g., AOX1 for P. pastoris, T7 for E. coli)

  • Include purification tags (His6 or Strep) preferably at the C-terminus to avoid interference with signal peptide function

  • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Optimize induction conditions (temperature, inducer concentration, duration)

Purification strategy:

  • Cell disruption: Mechanical methods (French press, sonication) or enzymatic lysis

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (DDM, LMNG, or GDN)

  • Affinity chromatography (IMAC for His-tagged constructs)

  • Size exclusion chromatography for final polishing and buffer exchange

  • Quality assessment by SDS-PAGE (target purity >85%) and Western blotting

Critical parameters to monitor:

  • Detergent concentration: Must be above CMC but minimized to prevent protein denaturation

  • Temperature: Perform purification at room temperature to maintain native conformation of this thermostable protein

  • Buffer composition: Include stabilizing agents (glycerol 10-15%, specific lipids)

  • pH stability range: Test multiple pH conditions to identify optimal stability

Storage recommendations:

  • Store purified protein in buffer containing reducing agent and appropriate detergent

  • Flash-freeze aliquots in liquid nitrogen

  • Store at -80°C for up to 6 months (liquid form) or 12 months (lyophilized form)

How can I design functional assays to evaluate the activity of recombinant TatC protein in vitro?

Designing functional assays for recombinant TatC protein requires careful consideration of its native role in protein translocation. The following methodologies are recommended for comprehensive functional characterization:

  • Substrate binding assays:

    • Develop fluorescence anisotropy assays using labeled Tat signal peptides

    • Employ microscale thermophoresis to measure binding affinities

    • Use surface plasmon resonance to determine kinetic parameters of TatC-substrate interactions

    • Consider thermal shift assays to evaluate substrate-induced stabilization

  • Reconstituted translocation assays:

    • Reconstitute TatC into liposomes with defined lipid composition

    • Include purified TatA and TatB components if studying the complete translocation system

    • Use fluorescently labeled substrate proteins with authentic twin-arginine signal peptides

    • Quantify translocation efficiency through protease protection assays or fluorescence quenching

  • ATPase activity measurements:

    • While the Tat system is generally considered pmf-dependent rather than ATP-dependent, monitor potential ATPase activity using colorimetric phosphate release assays

    • Compare activity in the presence and absence of substrate proteins and other Tat components

  • Temperature-dependent activity profiling:

    • Assess functionality across a temperature range (25-80°C) to determine thermal activity profile

    • Compare with TatC homologs from mesophilic organisms to highlight thermostability features

  • Crosslinking studies:

    • Employ photo-crosslinking with strategically placed crosslinkers to map interaction sites

    • Use mass spectrometry to identify crosslinked peptides and infer structural arrangements

Experimental controls:

  • Include inactive TatC mutants (site-directed mutations in conserved residues)

  • Test non-Tat substrates to confirm specificity

  • Use detergent-solubilized TatC as a negative control for liposome-reconstituted experiments

Data interpretation considerations:

  • Account for the thermophilic nature of C. hydrogenoformans when interpreting temperature effects

  • Consider the impact of detergents and lipid composition on activity

  • Validate findings using multiple complementary assays

These methodological approaches provide a comprehensive framework for characterizing the functional properties of recombinant C. hydrogenoformans TatC, enabling researchers to understand its role in protein translocation at the molecular level .

What strategies can help resolve inconsistent results when working with recombinant TatC protein?

When facing inconsistent results with recombinant TatC protein, implement the following systematic troubleshooting approach:

  • Protein quality assessment:

    • Verify protein integrity through multiple methods (SDS-PAGE, Western blot, mass spectrometry)

    • Assess protein homogeneity using size exclusion chromatography and dynamic light scattering

    • Confirm proper folding through circular dichroism or limited proteolysis

    • Verify the absence of aggregation using analytical ultracentrifugation

  • Storage and handling evaluation:

    • Test different storage conditions and their impact on protein stability

    • Minimize freeze-thaw cycles by preparing single-use aliquots

    • Compare fresh preparations with stored samples to identify potential degradation

    • Consider stabilizing additives (glycerol, specific lipids, reducing agents)

  • Experimental conditions optimization:

    • Systematically vary buffer components (pH, salt concentration, additives)

    • Test temperature effects on assay performance (particularly relevant for this thermophilic protein)

    • Optimize detergent type and concentration if working with the membrane protein in solution

    • Consider the impact of different lipid compositions in reconstituted systems

  • Batch-to-batch variation analysis:

    • Implement standardized quality control metrics for each preparation

    • Maintain detailed records of expression and purification parameters

    • Consider using internal standards to normalize between batches

    • Pool multiple preparations for critical experiments requiring large amounts of protein

  • Method validation:

    • Validate assays using well-characterized control proteins before testing TatC

    • Implement positive and negative controls in each experiment

    • Use multiple complementary methods to measure the same parameter

    • Consider blind testing to eliminate experimenter bias

When analyzing contradictory data, follow the structured approach outlined in section 2.2, embracing unexpected results as potential opportunities for new discoveries rather than merely experimental failures .

How should researchers interpret structure-function relationships of TatC in the context of C. hydrogenoformans' extreme environment?

Interpreting structure-function relationships of TatC from an extremophile like C. hydrogenoformans requires special considerations to account for its adaptation to high temperatures:

  • Contextual comparison framework:

    • Always interpret structural features and functional parameters in comparison with mesophilic homologs

    • Consider the native growth temperature (optimally 78°C) when evaluating stability and activity data

    • Recognize that apparent "abnormal" features may represent adaptations to extreme conditions

  • Thermostability-function correlation analysis:

    • Distinguish between adaptations critical for function versus those merely enhancing thermostability

    • Interpret mutational studies cautiously, as residues may serve different roles than in mesophilic homologs

    • Consider that optimal activity temperature may not match optimal growth temperature

  • Structural flexibility considerations:

    • Analyze dynamic properties alongside static structural features

    • Remember that thermophilic proteins often exhibit reduced flexibility at moderate temperatures but appropriate flexibility at their physiological temperature

    • Use molecular dynamics simulations at various temperatures to predict behavior in the native environment

  • Evolution-guided interpretation:

    • Consider the potential impact of lateral gene transfer on TatC structure and function

    • Similar to the cooF and cooS genes that show evidence of lateral transfer, TatC might have mixed evolutionary origins affecting its properties

    • Analyze conserved versus variable regions in the context of phylogenetic information

  • Methodological temperature adjustments:

    • For in vitro functional assays, test activity across temperature ranges, not just at standard laboratory conditions

    • Consider that protein-protein interactions may have different temperature optima than enzymatic activities

    • Remember that buffer components may behave differently at elevated temperatures

  • Integration of multiple data types:

    • Combine structural data (X-ray, cryo-EM, NMR) with functional assays and computational predictions

    • Develop integrated models that account for temperature effects on all components of the translocation system

    • Consider how membrane properties change with temperature and how this affects TatC function

By applying these interpretive frameworks, researchers can develop more accurate models of how TatC functions in the context of C. hydrogenoformans' extreme environment, potentially revealing novel principles of protein adaptation to high temperatures that could inform protein engineering applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.