Recombinant Carboxydothermus hydrogenoformans UPF0059 membrane protein CHY_2560 (CHY_2560)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant CHY_2560 is synthesized in Escherichia coli expression systems. Key parameters include:

ParameterDetail
Expression vectorProprietary plasmid optimized for thermostable protein production
TagVariable (determined during production; commonly His- or GST-tag)
Storage bufferTris-based buffer (pH 7.4–8.0), 50% glycerol
Storage temperature–20°C (short-term); –80°C (long-term)
Purity>90% (SDS-PAGE verified)

Recombinant yields are enhanced through codon harmonization and transcriptional tuning, strategies proven effective for membrane proteins in E. coli .

Functional Insights

While CHY_2560’s exact biological role remains unclear, genomic and phylogenetic data provide clues:

  • Genomic context: Located near operons encoding CO dehydrogenase (CODH) and hydrogenase complexes, suggesting potential involvement in CO metabolism or electron transport .

  • Homology: Shares weak similarity with rubrerythrin-associated redox proteins in anaerobic bacteria .

  • Inferred function: Hypothesized to act as a membrane-bound electron carrier or stress-response modulator under high CO conditions .

Research Applications

CHY_2560 is primarily used in:

  1. Structural biology: Crystallization trials to resolve membrane protein architectures.

  2. Enzyme mechanism studies: Investigating thermostability and ion-channel dynamics.

  3. Biotechnological tool development: Engineering heat-stable membrane scaffolds for industrial biocatalysis .

Challenges and Future Directions

  • Functional annotation: No direct enzymatic activity has been experimentally verified.

  • Interaction mapping: Potential partners (e.g., CODH-IV, hydrogenase subunits) require validation via co-immunoprecipitation .

  • Industrial adaptation: Codon optimization and E. coli strain engineering (e.g., LEMO21(DE3)) could improve heterologous production yields .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mntP; CHY_2560; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Target Names
mntP
Target Protein Sequence
MSLWEIFLLAVALGTDSFSLCVGLGMGKIKRKEIIALSLTVLVYHIVMPILGWFAGDLTG RFLGKVATYIGGAILIYLGYKMIRHGISQEEELPHVTYNLVGLLLIGLSVSMDALSVGFT LGTVKVNLWFVALITGIVAGVMTLSGLLLGRRVSKVLGERAQIVGGLILLLIAGKLIFRG
Uniprot No.

Target Background

Function
Putative manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Carboxydothermus hydrogenoformans and what makes it significant for research?

Carboxydothermus hydrogenoformans is a thermophilic, strictly anaerobic, gram-positive bacterium that catalyzes the water gas shift reaction, converting carbon monoxide with water to hydrogen and carbon dioxide. This organism is particularly significant because it grows at thermodynamically favorable high temperatures compared to industrial catalytic processes, making it potentially valuable for hydrogen production applications . Additionally, C. hydrogenoformans has been found to possess metabolic versatility beyond what was initially recognized, including the ability to use multiple electron donors and acceptors in anaerobic respiration .

The bacterium was originally thought to use only CO and pyruvate as energy sources, but research has demonstrated that it can oxidize formate, lactate, glycerol, CO, and H₂ with appropriate electron acceptors such as 9,10-anthraquinone-2,6-disulfonate (AQDS). It can also reduce various compounds including sulfite, thiosulfate, sulfur, nitrate, and fumarate with lactate as an electron donor . This metabolic flexibility makes C. hydrogenoformans an excellent model organism for studying energy conversion processes in extremophiles.

What is known about UPF0059 membrane protein CHY_2560?

UPF0059 membrane protein CHY_2560 is a relatively uncharacterized membrane protein from C. hydrogenoformans. The protein consists of 180 amino acids and is predicted to have multiple transmembrane segments based on its sequence . The "UPF" designation (Uncharacterized Protein Family) indicates that this protein belongs to a family whose function has not been experimentally determined.

The amino acid sequence (MSLWEIFLLAVALGTDSFSLCVGLGMGKIKRKEIIALSLTVLVYHIVMPILGWFAGDLTGRFLGKVATYIGGAILIYLGYKMIRHGISQEEELPHVTYNLVGLLLIGLSVSMDALSVGFTLGTVKVNLWFVALITGIVAGVMTLSGLLLGRRVSKVLGERAQIVGGLILLLIAGKLIFRG) suggests it is highly hydrophobic with multiple predicted transmembrane domains, consistent with its classification as a membrane protein . Understanding proteins like CHY_2560 is critical for comprehending how C. hydrogenoformans adapts to extreme environments and performs its unique metabolic functions.

How does C. hydrogenoformans' metabolism relate to membrane protein function?

C. hydrogenoformans has a specialized metabolism centered around the water gas shift reaction but has demonstrated more versatility than initially thought. Its ability to convert CO to H₂ and CO₂ is thermodynamically favorable at its growth temperature (around 65°C) . Membrane proteins likely play crucial roles in this organism's energy conservation mechanisms, possibly including proton translocation across membranes to generate ATP.

Research has shown that when C. hydrogenoformans cultures reach low CO levels, the organism appears to shift from a hydrogenogenic metabolism (producing H₂) to an acetogenic metabolism (producing acetate) . This metabolic shift suggests that membrane proteins may be involved in sensing environmental conditions and facilitating alternative metabolic pathways. Additionally, experiments with C. hydrogenoformans have demonstrated that it can simultaneously reduce fumarate and produce hydrogen when growing on CO as an electron donor, indicating complex electron transfer mechanisms that likely involve membrane-bound proteins .

What expression systems are most effective for producing recombinant CHY_2560?

The recombinant expression of membrane proteins presents significant challenges compared to soluble proteins. For CHY_2560 specifically, E. coli expression systems have been successfully used to produce the full-length protein with an N-terminal His tag . E. coli offers advantages including rapid growth, high protein yields, and well-established protocols for membrane protein expression.

When working with membrane proteins from thermophilic organisms like C. hydrogenoformans, expression systems should be selected with consideration for the protein's native environment. While E. coli provides good yields and shorter turnaround times, other expression hosts may be considered depending on experimental needs :

  • Yeast expression systems - Offer good yields with eukaryotic post-translational modifications

  • Insect cell systems - Provide many post-translational modifications necessary for correct protein folding

  • Mammalian cell systems - May help retain protein activity through appropriate post-translational modifications

For initial characterization studies, E. coli remains the most practical choice for CHY_2560 expression due to established protocols and higher yields, though researchers should be aware that proper folding may require optimization.

What purification strategies yield optimal results for CHY_2560?

Purification of membrane proteins requires specialized approaches due to their hydrophobicity. For CHY_2560, affinity chromatography using the N-terminal His tag has proven effective . A general purification workflow for CHY_2560 would include:

  • Cell lysis under conditions that preserve protein structure

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization using appropriate detergents (typically non-ionic or zwitterionic detergents)

  • Immobilized metal affinity chromatography (IMAC) using the His tag

  • Size exclusion chromatography for additional purification if needed

The published protocols indicate that CHY_2560 purified through this approach yields protein with greater than 90% purity as determined by SDS-PAGE . When working with membrane proteins from thermophilic organisms, incorporating thermostability assessments during purification can help ensure the protein maintains its native conformation.

What special considerations apply when working with membrane proteins from thermophilic organisms?

Membrane proteins from thermophiles like C. hydrogenoformans require special considerations during expression and purification:

  • Temperature optimization: While the native organism grows at approximately 65°C, expression hosts typically cannot withstand such temperatures. Therefore, expression conditions must be optimized to balance protein production with proper folding.

  • Detergent selection: Thermophilic membrane proteins often require different detergents than their mesophilic counterparts. Detergents with higher stability at elevated temperatures may be preferable during purification and subsequent experiments.

  • Buffer composition: Buffers should be selected that maintain stability across a wider temperature range to accommodate thermal stability studies.

  • Structural preservation: Thermophilic proteins often lose their native conformation when removed from their high-temperature environment. Incorporating stabilizing agents or performing certain analyses at elevated temperatures may help maintain physiologically relevant conformations.

  • Avoiding freeze-thaw cycles: As noted in the product information, repeated freezing and thawing should be avoided as this can lead to protein denaturation and aggregation .

What techniques are most effective for studying the structure of CHY_2560?

Determining the structure of membrane proteins presents significant challenges compared to soluble proteins. For CHY_2560, researchers might consider:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural determination and may be suitable for CHY_2560, especially if it can be purified in sufficient quantities and stability.

  • X-ray crystallography: While challenging for membrane proteins, advances in crystallization methods for membrane proteins make this approach feasible. Lipidic cubic phase (LCP) crystallization has proven successful for many membrane proteins.

  • Nuclear Magnetic Resonance (NMR): For specific domains or smaller segments of CHY_2560, solution or solid-state NMR can provide valuable structural information.

  • Computational modeling: Given that CHY_2560 belongs to the UPF0059 family, homology modeling based on related proteins with known structures can provide initial structural insights.

  • Membrane topology mapping: Techniques such as cysteine scanning mutagenesis combined with accessibility assays can help determine which portions of the protein are exposed to different environments.

For any structural study, maintaining protein stability during analysis is critical. Given C. hydrogenoformans' thermophilic nature, structural studies may benefit from conditions that mimic its natural thermal environment.

How can researchers investigate the potential function of uncharacterized CHY_2560?

Since CHY_2560 belongs to an uncharacterized protein family (UPF0059), determining its function requires multiple complementary approaches:

  • Comparative genomics: Analyzing the gene neighborhoods of CHY_2560 homologs across different species can provide functional context. If CHY_2560 consistently appears near genes of known function, this may suggest involvement in related processes.

  • Gene knockout/knockdown studies: Creating C. hydrogenoformans strains with altered CHY_2560 expression and observing phenotypic changes can suggest function. This might reveal whether CHY_2560 is involved in the organism's CO metabolism or other metabolic pathways.

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation or cross-linking coupled with mass spectrometry can identify proteins that interact with CHY_2560, providing functional clues.

  • Metabolic profiling: Comparing metabolite profiles between wild-type and CHY_2560-modified strains may reveal metabolic pathways affected by the protein.

  • Biochemical assays: Based on predictions from sequence analysis, targeted biochemical assays can test specific hypotheses about protein function (e.g., transport activity, enzymatic function).

Given C. hydrogenoformans' ability to perform the water gas shift reaction and its metabolic shift from hydrogenogenic to acetogenic metabolism , investigating whether CHY_2560 plays a role in these processes would be particularly valuable.

What can sequence analysis tell us about potential functions of CHY_2560?

Sequence analysis provides valuable initial insights into potential functions of uncharacterized proteins like CHY_2560. The amino acid sequence of CHY_2560 reveals several features that may suggest function :

  • Transmembrane topology prediction: Analysis of the sequence (MSLWEIFLLAVALGTDSFSLCVGLGMGKIKRKEIIALSLTVLVYHIVMPILGWFAGDLTGRFLGKVATYIGGAILIYLGYKMIRHGISQEEELPHVTYNLVGLLLIGLSVSMDALSVGFTLGTVKVNLWFVALITGIVAGVMTLSGLLLGRRVSKVLGERAQIVGGLILLLIAGKLIFRG) suggests multiple hydrophobic segments consistent with transmembrane domains.

  • Conserved motifs: The sequence contains a potential nucleotide-binding motif (GMGK), which might indicate involvement in ATP/GTP binding or hydrolysis, though further experimental validation would be needed.

  • Homology to characterized proteins: While CHY_2560 belongs to an uncharacterized family, distant homology to proteins of known function might provide functional hypotheses. Tools like HHpred can detect remote homologs that might not be identified through standard BLAST searches.

  • Secondary structure prediction: Analyzing the predicted secondary structure elements can suggest structural features that correlate with function, such as channel-forming helices or substrate-binding domains.

Integrating these sequence-based predictions with experimental approaches is essential for moving beyond speculation about CHY_2560's function.

How might CHY_2560 contribute to C. hydrogenoformans' unique metabolic capabilities?

C. hydrogenoformans demonstrates remarkable metabolic versatility, including the ability to convert CO to H₂ and CO₂ through the water gas shift reaction and to switch between hydrogenogenic and acetogenic metabolism depending on conditions . As a membrane protein, CHY_2560 could potentially be involved in several aspects of these metabolic processes:

  • Metabolite transport: CHY_2560 might function as a transporter for substrates or products involved in C. hydrogenoformans' metabolism, potentially including CO, H₂, CO₂, or metabolic intermediates.

  • Energy conservation: The protein could participate in energy conservation mechanisms, possibly as part of an electron transport chain or proton translocation system.

  • Metabolic regulation: CHY_2560 might serve as a sensor for environmental conditions (such as CO concentration), helping regulate the metabolic shift observed when CO levels decrease.

  • Membrane integrity maintenance: The protein could play a structural role in maintaining membrane integrity under the extreme conditions in which C. hydrogenoformans thrives.

Research has shown that C. hydrogenoformans can reduce electron acceptors like fumarate while simultaneously producing hydrogen from CO , suggesting complex membrane-associated electron transfer systems that CHY_2560 might participate in.

What methodological approaches can assess membrane protein interactions in thermophilic systems?

Studying membrane protein interactions in thermophilic systems requires specialized approaches that account for the high-temperature environment and unique membrane composition:

  • Co-purification at elevated temperatures: Performing protein complex isolation at temperatures closer to the organism's growth optimum (65°C for C. hydrogenoformans) may preserve physiologically relevant interactions.

  • Crosslinking under native conditions: Chemical crosslinking performed under conditions that mimic the native environment can capture transient interactions before membrane disruption.

  • Fluorescence resonance energy transfer (FRET): If genetic manipulation of C. hydrogenoformans is feasible, FRET-based approaches using fluorescently tagged proteins can detect interactions in living cells.

  • Surface plasmon resonance (SPR) at variable temperatures: SPR with temperature control can assess binding kinetics and affinities at temperatures relevant to thermophilic systems.

  • Native mass spectrometry: This technique can analyze intact membrane protein complexes, providing information about subunit composition and stoichiometry.

When investigating CHY_2560 interactions specifically, researchers should consider whether it might interact with proteins involved in the water gas shift reaction or in the metabolic shift from hydrogenogenic to acetogenic pathways observed in C. hydrogenoformans .

How can synthetic biology approaches utilize insights from CHY_2560 research?

Understanding CHY_2560 and other membrane proteins from C. hydrogenoformans could inform synthetic biology applications, particularly in developing systems for hydrogen production or carbon monoxide utilization:

  • Engineered hydrogen production systems: If CHY_2560 is involved in hydrogen metabolism, understanding its structure and function could inform the design of optimized hydrogen production systems. C. hydrogenoformans can achieve remarkably low CO levels (below 2 ppm with CO₂ removal) , making its proteins potentially valuable for developing clean hydrogen production processes.

  • Thermostable membrane protein scaffolds: The inherent thermostability of proteins from C. hydrogenoformans makes them potential scaffolds for engineering membrane proteins with enhanced stability for biotechnological applications.

  • Novel bioremediation approaches: Insights into how C. hydrogenoformans metabolizes carbon monoxide could inform development of bioremediation systems for CO-containing industrial waste streams.

  • Metabolic engineering for alternative energy: Understanding the metabolic versatility of C. hydrogenoformans, potentially including the role of CHY_2560, could inform metabolic engineering efforts to create organisms capable of producing hydrogen or other valuable products from waste gases.

The finding that C. hydrogenoformans can simultaneously reduce fumarate and produce hydrogen when growing on CO suggests complex electron transfer mechanisms that could inspire design of synthetic electron transfer systems.

What strategies can overcome common issues in membrane protein purification?

Membrane protein purification presents unique challenges. For CHY_2560 and similar proteins, researchers can employ these strategies to overcome common issues:

  • Aggregation problems:

    • Try different detergents or detergent mixtures

    • Add stabilizing agents like glycerol or specific lipids

    • Optimize temperature during purification steps

    • Consider using amphipols or nanodiscs for improved stability

  • Low expression yields:

    • Test different promoter strengths and induction conditions

    • Try fusion tags known to enhance membrane protein expression (e.g., Mistic, SUMO)

    • Consider codon optimization for the expression host

    • Evaluate different E. coli strains specifically designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Protein misfolding:

    • Lower the expression temperature to allow more time for proper folding

    • Co-express with chaperones that assist membrane protein folding

    • Consider expression hosts that better match the native environment

  • Maintaining activity during purification:

    • Include appropriate cofactors or substrates in purification buffers

    • Minimize exposure to conditions that might denature the protein

    • Verify protein activity at intermediate purification steps

For CHY_2560 specifically, its thermophilic origin suggests that temperature management during purification could be particularly important for maintaining proper structure.

How can researchers assess if recombinant CHY_2560 maintains its native conformation?

Verifying that recombinant CHY_2560 adopts its native conformation is crucial for functional studies. Several approaches can assess proper folding:

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content and can be performed at different temperatures to assess thermal stability.

  • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence can indicate whether hydrophobic residues are properly buried within the membrane or exposed due to misfolding.

  • Limited proteolysis: Properly folded proteins typically show distinct, reproducible fragmentation patterns when subjected to limited proteolysis.

  • Thermal shift assays: These can assess protein stability and whether the recombinant protein displays the expected thermostability of a protein from a thermophilic organism.

  • Functional assays: If hypotheses about CHY_2560's function can be developed, functional assays would provide the most relevant assessment of proper folding.

Given C. hydrogenoformans' growth temperature of approximately 65°C , recombinant CHY_2560 should demonstrate significant thermostability if properly folded, which can be used as an indicator of native conformation.

What experimental controls are essential when working with uncharacterized membrane proteins?

  • Expression controls:

    • Empty vector controls to distinguish background effects from protein-specific effects

    • Expression of a well-characterized membrane protein using the same system to validate methodology

  • Purification controls:

    • Parallel purification of a well-characterized membrane protein to validate purification protocols

    • Mock purifications from cells not expressing the target protein to identify non-specific binding contaminants

  • Functional assay controls:

    • Appropriate positive controls using proteins of known function

    • Heat-denatured protein samples to distinguish specific activity from non-specific effects

    • Site-directed mutants of predicted functional residues to validate mechanistic hypotheses

  • Localization controls:

    • Markers for different cellular compartments when assessing protein localization

    • Known membrane proteins as positive controls for membrane fractionation procedures

  • Interaction studies controls:

    • Unrelated membrane proteins to identify non-specific interactions

    • Reciprocal pull-down experiments to confirm interaction specificity

These controls are particularly important when working with proteins like CHY_2560 from the UPF0059 family where function is not yet established, and experimental artifacts could lead to incorrect functional assignments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.