Recombinant Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Catalytic Activity and Substrate Specificity

Recombinant CLS catalyzes the final step of CL biosynthesis by transferring a phosphatidyl group from CDP-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG), producing CL and CMP . Key features include:

  • Substrate Utilization: Requires CDP-DAG and PG for CL synthesis .

  • Enzyme Purity: Recombinant hCLS1 (human CLS) shows no significant activity toward phosphatidylglycerophosphate synthase (PGS), confirming specificity .

  • Enzyme Localization: Mitochondrial localization confirmed via subcellular fractionation and immunohistochemistry .

Table 1: Recombinant CLS Enzymes and Their Sources

OrganismRecombinant CLS TypeExpressed inKey Findings
Homo sapienshCLS1 (CDP-alcohol transferase)COS-7 cells, insect cellsIncreased CL synthesis; mitochondrial localization; high expression in heart, skeletal muscle, liver .
Saccharomyces cerevisiaeScCrd1 (CDP-alcohol transferase)Yeast modelsComplementation in CRD1-deficient yeast; impaired CL remodeling in cross-species systems .
Streptomyces coelicolorSco1389 (CDP-alcohol transferase)Rhizobium etli mutantsRestores CL formation in CL-deficient bacteria; shares catalytic mechanism with eukaryotes .

Tissue-Specific Expression and Mitochondrial Function

rCLS is expressed in tissues with high energy demands:

  • High Expression: Heart, skeletal muscle, liver, pancreas, kidney, and small intestine .

  • Mitochondrial Role: CLS deficiency disrupts respiratory supercomplex formation, reduces ATP production, and increases reactive oxygen species (ROS) .

Table 2: Impact of CLS Knockdown on Cardiomyocyte Function

ParameterWild-TypeCLS KnockdownSource
Cardiolipin LevelsNormal↓ CL72:8, CL72:9, CL74:8, CL74:9
Oxygen Consumption RateBaseline↑ (mitochondrial uncoupling)
Oxidative Stress MarkersLow↑ (ROS accumulation)

Cross-Species Complementation and CL Remodeling

  • Bacterial CLS (TbCLS): A phospholipase D (PLD)-type CLS from Trypanosoma brucei complements CL deficiency in CRD1-deficient yeast but fails to restore CL remodeling .

  • Eukaryotic CLS (ScCrd1): Cannot complement CLS-deficient trypanosomes, highlighting species-specific CLS-remodeling interactions .

Role in Metabolic and Cardiac Diseases

  • Barth Syndrome: Mutations in Tafazzin (involved in CL remodeling) cause CL deficiency, linking CLS activity to mitochondrial dysfunction in this X-linked disorder .

  • Catecholamine-Induced Cardiomyopathy: CLS downregulation correlates with mitochondrial uncoupling, oxidative stress, and CL species depletion in murine models .

CLS as a Drug Target

  • Antibacterial Therapy: CLS inhibitors could target bacterial CL synthesis in pathogens like Moraxella catarrhalis, where CL is essential for membrane integrity .

  • Mitochondrial Diseases: Modulating CLS activity may address CL deficiencies in neurodegenerative or metabolic disorders .

Challenges in CLS Purification and Activity Assays

  • Membrane Association: Recombinant CLS enzymes are tightly bound to membranes, complicating purification .

  • Substrate Availability: CDP-DAG and PG must be synthesized in vitro or provided exogenously, limiting high-throughput assays .

Emerging Tools for CLS Research

  • CRISPR-Based Models: Cardiomyocyte-specific CLS knockdown enables precise studies of CLS role in cardiac pathology .

  • Lipidomics: High-resolution mass spectrometry identifies CL species changes in CLS-deficient models, linking specific CL fatty acids to mitochondrial function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; YPTB2111; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
clsA
Target Protein Sequence
MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERAKAMWPSTARWLSELKECQHIFANSNSEVATPLFQLCERRQGINGVKGNQ LQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAAARRGVHCRLLLD SAGSKQFFRSPYPAMMRNAGIEVVEALKVNVFRMFLRRMDLRQHRKIVLIDNYVAYTGSM NMVDPRFFKQDAGVGQWIDMMARMEGPVATTLGIVYACDWEIETGKRILPPPPDANIMPF EEETGHTIQVIASGPGFPEEMIHQALLTAVYAAREQLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPRENDSMMVRWASRAFFTELLNAGVKIYQFEGGLLHSKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGADLAQVQDDYIARSALLDGERWNKRPLWHRVTERLFY FFSPLL
Uniprot No.

Target Background

Function
Recombinant Cardiolipin synthase (cls) catalyzes the reversible transfer of a phosphatidyl group between phosphatidylglycerol molecules, forming cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Database Links

KEGG: ypo:BZ17_350

Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of cardiolipin synthase (CLS) in mitochondrial function?

Cardiolipin synthase (CLS) plays a pivotal role in synthesizing cardiolipin, a unique phospholipid localized exclusively to the inner mitochondrial membrane. Cardiolipin is essential for maintaining mitochondrial structure and function, including membrane curvature, respiratory chain supercomplex formation, and energy metabolism. CLS catalyzes the transfer of a phosphatidyl group from cytidine diphosphate-diacylglycerol (CDP-DAG) to phosphatidylglycerol (PG), forming nascent cardiolipin . This process is critical for mitochondrial bioenergetics, as cardiolipin deficiency leads to impaired oxidative phosphorylation, decreased ATP production, and increased reactive oxygen species (ROS) generation .

In mammalian systems, CLS activity is tightly regulated to meet tissue-specific energy demands. For instance, human CLS1 (hCLS1) is highly expressed in cardiac and skeletal muscles, organs with high mitochondrial activity . Experimental studies have demonstrated that overexpression of hCLS1 increases cardiolipin synthesis without affecting other phospholipid pathways, emphasizing its specificity and importance in mitochondrial health .

How can recombinant CLS be utilized to study cardiolipin biosynthesis?

Recombinant CLS enables researchers to investigate the biochemical pathways underlying cardiolipin biosynthesis by providing a controlled system for enzyme expression and activity analysis. Recombinant hCLS1 has been successfully expressed in mammalian cell lines such as COS-7 cells, where it efficiently catalyzed cardiolipin synthesis using CDP-DAG and PG substrates . This approach allows for detailed characterization of enzyme kinetics, substrate specificity, and regulatory mechanisms.

To study recombinant CLS activity in vitro, researchers typically use radiolabeled substrates like [14C]oleoyl-CoA or [14C]PG to trace lipid synthesis pathways . These assays are complemented by lipid extraction techniques and thin-layer chromatography (TLC) for product identification. Additionally, subcellular localization studies using immunohistochemistry or fractionation methods confirm the mitochondrial targeting of recombinant CLS proteins .

Recombinant systems also facilitate mutational analyses to identify critical residues involved in catalysis or regulation. For example, mutations in catalytic motifs of bacterial CLS isoforms have been shown to disrupt cardiolipin synthesis, providing insights into enzyme structure-function relationships .

What experimental designs are recommended for studying CLS activity under physiological conditions?

Experimental designs for studying CLS activity should incorporate replication, randomization, blocking, and appropriate sample sizes to ensure robust and reproducible results . Key considerations include:

  • Replication: Multiple biological replicates are essential to account for variability in enzyme expression or activity across different samples.

  • Randomization: Random assignment of treatments or conditions minimizes bias and ensures that observed effects are attributable to the experimental variables.

  • Blocking: Grouping samples based on shared characteristics (e.g., growth phase or genetic background) reduces confounding factors.

  • Sample Size: Adequate sample sizes are crucial for statistical power and reliable inference.

For physiological studies, researchers often use cell lines or animal models with tissue-specific expression of CLS. For instance, RNAi-mediated knockdown of CLS in Drosophila melanogaster has revealed its role in cardiac function under stress conditions . Similarly, transgenic mouse models overexpressing human CLS provide insights into its impact on lipidomic flux and mitochondrial respiration under normal and pathological conditions .

How can data contradictions be addressed when studying CLS-related pathways?

Data contradictions in CLS research often arise from differences in experimental conditions, model systems, or analytical methods. To address these discrepancies:

  • Standardize Experimental Conditions: Ensure consistency in substrate concentrations, incubation times, temperature settings, and buffer compositions across experiments.

  • Compare Model Systems: Recognize that findings from bacterial systems may not directly translate to eukaryotic contexts due to differences in enzyme isoforms or regulatory mechanisms .

  • Validate Results with Multiple Techniques: Use complementary methods such as mass spectrometry-based lipidomics, TLC analysis, or enzymatic assays to corroborate findings .

  • Perform Meta-Analyses: Integrate data from multiple studies using statistical tools to identify overarching trends or reconcile conflicting observations.

For example, discrepancies regarding the substrate specificity of bacterial ClsC were resolved by demonstrating its unique ability to utilize phosphatidylethanolamine (PE) as a donor molecule under specific conditions . Similarly, studies on mammalian hCLS1 have clarified its exclusive role in cardiolipin synthesis without affecting phosphatidylglycerophosphate synthase activity .

What are the implications of CLS depletion on cellular function?

Depletion of CLS has profound effects on cellular function due to its central role in maintaining mitochondrial integrity. In cardiac cells, reduced CLS expression leads to lower levels of tetralinoleoyl-cardiolipin (CL72:8), impaired systolic performance, slower diastolic filling velocity, and increased oxidative stress . These changes are associated with mitochondrial uncoupling and enhanced oxygen consumption rates.

In bacterial systems like Escherichia coli, deletion mutants lacking all three Cls isoforms exhibit complete loss of detectable cardiolipin regardless of growth phase or osmolarity conditions . This deficiency disrupts membrane organization and compromises cell viability under stress conditions.

The physiological significance of CLS depletion extends to human diseases such as heart failure with reduced ejection fraction (HFrEF), where cardiac samples show significant reductions in CL species . These findings highlight the potential therapeutic value of targeting CLS pathways to restore mitochondrial function.

How does osmolarity influence CLS activity and cardiolipin synthesis?

Osmolarity plays a critical role in regulating CLS activity and cardiolipin synthesis. In E. coli, ClsA contributes detectable levels of cardiolipin during logarithmic growth at low osmolarity but becomes inactive under high osmolarity conditions . Conversely, ClsB and ClsC exhibit increased activity during stationary phase at elevated osmolarity levels.

The osmotic regulation of ClsA involves flipping its catalytic domain between cytoplasmic and periplasmic leaflets of the inner membrane. This phenomenon ensures adequate supply of nonbilayer-prone CL under PE-deficient conditions or osmotic down-shock scenarios . Such adaptive mechanisms underscore the self-organizing potential of lipid biosynthetic enzymes.

In mammalian systems, osmotic stress may indirectly affect CLS activity by altering mitochondrial membrane composition or dynamics. Further research is needed to elucidate these effects.

What methodologies are available for cloning and characterizing recombinant CLS genes?

Cloning recombinant CLS genes typically involves isolating cDNA sequences encoding the enzyme followed by insertion into suitable expression vectors. For mammalian hCLS1 cloning:

  • The cDNA sequence is amplified using PCR with specific primers designed from genomic databases.

  • The amplified product is subcloned into vectors like pcDNA3.1(+) for transient expression in mammalian cells such as COS-7 cells .

  • Expression is verified through Western blotting or immunohistochemical analysis.

Characterization methodologies include:

  • Enzyme Activity Assays: Radiolabeled substrates are used to quantify catalytic efficiency under varying conditions.

  • Substrate Specificity Tests: Alternative substrates like lysophosphatidylglycerol (LPG) or monolysocardiolipin help determine enzymatic preferences.

  • Localization Studies: Immunofluorescence microscopy confirms mitochondrial targeting.

  • Mutational Analysis: Site-directed mutagenesis identifies critical residues involved in catalysis or regulation.

These approaches provide comprehensive insights into recombinant CLS function while facilitating downstream applications such as drug screening or metabolic engineering.

How can researchers optimize experimental designs for studying novel CLS isoforms?

Optimizing experimental designs for novel CLS isoforms requires careful consideration of enzyme properties and physiological relevance:

  • Substrate Selection: Use substrates that mimic physiological conditions; for example, PG for eukaryotic ClsA/B/C or PE for bacterial ClsC-YmdB complexes.

  • Growth Conditions: Assess enzyme activity across different phases (logarithmic vs stationary) or stress scenarios (osmotic shock) .

  • Expression Systems: Choose expression hosts that support proper folding and localization; bacterial systems may suffice for prokaryotic isoforms while mammalian cells are ideal for eukaryotic enzymes.

  • Analytical Techniques: Employ advanced lipidomics tools like LC/MS/MS for precise quantification of synthesized cardiolipin species.

By integrating these elements into experimental designs, researchers can uncover novel regulatory mechanisms or catalytic modes associated with emerging CLS isoforms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.