Recombinant Carica papaya Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Carica papaya (Papaya)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFLYLASIVFLPWWISLSCNKSLKTWITNSWNTRQSETFLNDIQEKSLLEKF IQLEELFLLDEMIKEDPETHLQKLRIGIHKETIQFIQMYNEDRIHTILHFSTNILCFVIL SGYSILGNEELLIINSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHNDQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: cpap:5878417

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of cemA in Carica papaya chloroplast genome?

The cemA gene is part of the Carica papaya chloroplast genome, which has a total size of approximately 160,100 bp. Within the chloroplast genome, cemA is located in one of two structural haplotypes that have been identified: LSC_IRa_SSCrc_IRb and LSC_IRa_SSC_IRb . Like other chloroplast genomes, the C. papaya chloroplast genome consists of a large single-copy region (LSC), a small single-copy region (SSC), and two inverted repeat regions (IRa and IRb). Understanding this genomic context is essential for designing proper amplification strategies and recombinant expression systems for cemA.

What is the predicted structure and function of cemA protein in C. papaya?

The cemA protein in C. papaya is predicted to be a membrane-embedded protein located in the chloroplast envelope. While specific structural data for C. papaya cemA is limited, comparative analysis with other plant species suggests that it contains multiple transmembrane domains typical of envelope membrane proteins. Functionally, cemA is believed to be involved in CO2 uptake mechanisms and may play a role in the carbon concentration mechanism of photosynthesis. The protein likely interacts with other components of the photosynthetic machinery to facilitate efficient carbon fixation.

What expression systems are most effective for recombinant production of C. papaya cemA?

Based on experiences with other Carica papaya chloroplast proteins, several expression systems can be considered for cemA, each with distinct advantages and limitations:

  • Escherichia coli expression system: While commonly used for recombinant protein production, this system may yield insoluble or undetectable protein for membrane proteins like cemA. Similar challenges were observed with C. papaya glutamine cyclotransferase, where E. coli expression with various fusion tags (His-tag, thioredoxin, glutathione S-transferase, and pre-maltose-binding protein) resulted in either undetectable or insoluble protein .

  • Pichia pastoris expression system: This yeast system might yield low levels of active protein when fused with appropriate secretion signals like α-factor leader sequence, as observed with PQC .

  • Insect cell/baculovirus system: This has shown success with other C. papaya proteins, producing 15-50 mg/liter of active protein with various secretion signals . For membrane proteins like cemA, this system may provide a eukaryotic environment that facilitates proper folding and membrane insertion.

  • Plant-based expression systems: Given cemA's natural context in plant chloroplasts, tobacco or other plant-based expression systems may provide the most appropriate cellular machinery for proper folding and function.

What purification strategies optimize yield and activity of recombinant cemA?

For membrane proteins like cemA, purification requires specialized approaches:

  • Detergent selection: Screen multiple detergents (non-ionic, zwitterionic, etc.) to solubilize cemA while maintaining native structure

  • Affinity tags: N-terminal or C-terminal His-tags can facilitate purification, with consideration for tag removal using specific proteases like dipeptidyl peptidase I

  • Two-phase extraction: For membrane proteins, techniques similar to those used in supercritical CO2 extraction of C. papaya components might be adapted, with parameters including high pressure (250 bar), low temperature (35°C), and extended processing time (180 minutes)

  • Activity preservation: Validate protein activity throughout purification using appropriate functional assays specific to cemA's role in CO2 transport

How can I design effective primers for cloning the cemA gene from C. papaya?

When designing primers for cemA amplification from C. papaya:

  • Sequence analysis: Utilize the complete chloroplast genome sequence of C. papaya (160,100 bp) as reference

  • Flanking regions: Include 20-30 nucleotides complementary to cemA gene boundaries

  • Restriction sites: Add appropriate restriction sites compatible with your expression vector

  • Codon optimization: Consider codon optimization based on your expression system

  • PCR strategy: Implement RT-PCR approaches similar to those used for C. papaya glutamine cyclotransferase cloning

  • Alternative splicing: Consider the potential for RNA editing, as 46 RNA editing loci with an average editing efficiency of 63% have been identified in the C. papaya chloroplast genome

What analytical techniques are most informative for characterizing cemA structure and interactions?

For comprehensive characterization of recombinant cemA:

  • Mass spectrometry approaches:

    • MALDI-TOF mass spectroscopy for molecular weight determination

    • Peptide mass fingerprint analysis for sequence validation

    • LC-QToF-MS for high-resolution detection of post-translational modifications

  • Structural analysis:

    • Circular dichroism for secondary structure assessment

    • Cryo-electron microscopy for membrane protein visualization

    • X-ray crystallography (challenging for membrane proteins but potentially informative)

  • Interaction studies:

    • Co-immunoprecipitation with potential protein partners

    • Crosslinking mass spectrometry to identify proximal proteins

    • Fluorescence resonance energy transfer (FRET) for in vivo interaction studies

How can RNA editing patterns affect cemA expression and function in C. papaya?

RNA editing is a significant post-transcriptional modification in chloroplast genomes. In C. papaya, 46 RNA editing loci with an average editing efficiency of 63% have been identified across the chloroplast genome . For cemA specifically:

  • Editing site identification: Conduct comparative transcriptome analysis between genomic DNA and cDNA to identify potential C-to-U or other editing events within cemA transcripts

  • Functional impact:

    • Analyze whether editing creates or eliminates start/stop codons

    • Assess changes in amino acid properties (hydrophobicity, charge) resulting from editing

    • Evaluate conservation of editing sites across Caricaceae family members

  • Experimental validation:

    • Express both edited and unedited versions of cemA to compare functional differences

    • Site-directed mutagenesis to recreate or eliminate editing events

What role might cemA play in stress responses in C. papaya?

While direct evidence for cemA's role in stress responses is limited, several lines of research suggest potential involvement:

  • Environmental adaptation: The chloroplast genome contributes to "adaptation, diversification, and evolution of plant lineages" . cemA, as a component of this genome, may contribute to environmental adaptation mechanisms.

  • Photosynthetic efficiency under stress: As a protein potentially involved in CO2 uptake, cemA may influence photosynthetic efficiency under various stress conditions:

    • High temperature stress

    • Drought conditions

    • High light intensity

    • Nutrient limitations

  • Integration with antioxidant systems: C. papaya demonstrates significant antioxidant properties, with compounds that can "help scavenge the results of oxidative stress produced in the liver" . The photosynthetic machinery, including cemA, may interact with these antioxidant systems during stress conditions.

What are the main challenges in achieving functional expression of recombinant cemA?

Membrane proteins like cemA present several expression challenges:

  • Protein solubility and folding:

    • Challenge: Hydrophobic regions often lead to protein aggregation or inclusion body formation

    • Solution: Test multiple expression systems; C. papaya proteins have shown variable success across systems, with insect cell/baculovirus systems yielding 15-50 mg/liter of active protein compared to unsuccessful E. coli expression

  • Membrane integration:

    • Challenge: Proper insertion into membranes requires specialized cellular machinery

    • Solution: Expression with appropriate secretion signals; PQC N-terminally fused to a combined secretion signal/His-tag peptide was correctly processed by host signal peptidase

  • Post-translational modifications:

    • Challenge: Plant-specific modifications may be absent in heterologous systems

    • Solution: Evaluate N-glycosylation sites and cysteine positioning as these are conserved features in plant chloroplast proteins

How can I troubleshoot low yield or activity of recombinant cemA?

When encountering expression or activity issues:

ProblemPotential CausesTroubleshooting Approach
No detectable expressionToxicity to host, unsuitable codonsTry lower induction temperature (16-25°C), codon optimization, different host strains
Insoluble proteinImproper folding, aggregationExplore fusion partners (thioredoxin, GST, MBP), add solubilizing agents
Low activityImproper folding, missing cofactorsAdd potential cofactors to buffer, verify structural integrity
DegradationProtease sensitivityAdd protease inhibitors, reduce expression temperature
Poor membrane integrationInsufficient membrane spaceAdjust induction conditions, use specialized membrane protein expression strains

For reference, expression of C. papaya glutamine cyclotransferase in E. coli resulted in either undetectable or insoluble protein across multiple constructs, while insect cell/baculovirus system yielded 15-50 mg/liter of active protein .

What functional assays can verify the activity of recombinant cemA?

To confirm that recombinant cemA retains native functionality:

  • CO2 uptake assays:

    • Reconstitution in liposomes followed by carbonic anhydrase-coupled assays

    • pH-sensitive fluorescent probes to monitor proton flux associated with CO2 transport

  • Membrane integration verification:

    • Protease protection assays to confirm proper topology

    • Fluorescence-based membrane localization in appropriate expression systems

  • Interaction partner validation:

    • Pull-down assays with known interaction partners from photosynthetic machinery

    • Reconstitution with other chloroplast components to assess functional complexes

How has cemA evolved within the Caricaceae family?

The evolutionary patterns of cemA can be examined through comparative genomic approaches:

What computational approaches best predict cemA structure and function?

For in silico analysis of cemA:

  • Homology modeling:

    • Use structurally characterized membrane proteins as templates

    • Validate models through molecular dynamics simulations in membrane environments

  • Functional prediction:

    • Multiple sequence alignment to identify conserved functional domains

    • Protein-protein interaction networks to predict functional partners

  • Evolutionary analysis:

    • Phylogenetic comparisons across plant lineages

    • Selection pressure analysis (dN/dS ratios) to identify functionally important residues

The bioinformatic approaches should be similar to those used in the comparative analysis of V. pubescens and C. papaya chloroplast genomes, which revealed insights about gene evolution in the Caricaceae family .

How might cemA function contribute to photosynthetic efficiency in C. papaya?

As a chloroplast envelope membrane protein potentially involved in CO2 uptake:

  • Carbon concentration mechanism: cemA may facilitate efficient carbon fixation by increasing CO2 concentration around Rubisco

  • Photosynthetic adaptation: The protein could be involved in adapting photosynthetic efficiency to various environmental conditions

  • Integration with metabolic pathways: cemA likely coordinates with other components of photosynthetic and metabolic machinery to optimize energy utilization

Can cemA be used as a molecular marker for Caricaceae phylogenetic studies?

cemA has potential as a phylogenetic marker:

  • Conservation level: While specific information about cemA conservation is not provided in the search results, chloroplast genes generally show appropriate levels of conservation for phylogenetic studies

  • Structural context: cemA's location within the chloroplast genome, which shows structural haplotypes (LSC_IRa_SSCrc_IRb and LSC_IRa_SSC_IRb) in both V. pubescens and C. papaya , provides additional comparative data points

  • Selection patterns: Assessment of selection pressure on cemA across Caricaceae species could provide insights into functional constraints and evolutionary history

The comparison of chloroplast genomes between V. pubescens and C. papaya demonstrates the value of such analyses in understanding "adaptation, diversification, and evolution of plant lineages" , suggesting cemA could contribute to these phylogenetic studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.