Recombinant Carica papaya NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Carica papaya (Papaya)
Target Names
ndhE
Target Protein Sequence
MLLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDKRQLKGD IFSIFVIAIAAAEAAIGSAIVSSIYRNRKSTRINQSTLLNK
Uniprot No.

Target Background

Function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. It couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient.
Database Links

KEGG: cpap:5878365

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 4L and what is its function in Carica papaya?

NAD(P)H-quinone oxidoreductase subunit 4L in Carica papaya is a chloroplastic protein that functions as part of the NDH complex involved in cyclic electron flow around photosystem I. This enzyme catalyzes the electron transfer from NAD(P)H to quinones, playing a crucial role in chlororespiration and photoprotection. Similar to other plant species, the papaya version likely contributes to maintaining redox homeostasis in chloroplasts by mediating electron transport chains. The enzyme's ability to reduce quinones via a two-electron reduction mechanism is particularly significant in preventing the formation of reactive semiquinone intermediates that can lead to oxidative stress .

How does the structure of Carica papaya NAD(P)H-quinone oxidoreductase compare to similar enzymes in other plant species?

The structure of Carica papaya NAD(P)H-quinone oxidoreductase subunit 4L shares significant homology with corresponding subunits in other plant species like Arabidopsis thaliana. Although the complete crystal structure of the papaya enzyme has not been fully characterized, comparative analyses suggest it contains conserved domains for cofactor binding (NAD(P)H) and catalytic sites for quinone reduction. The chloroplastic localization signal peptide is typically present at the N-terminal region, directing the protein to chloroplasts after synthesis. Based on homology with other plant NDH complexes, the subunit 4L likely interacts with other NDH subunits such as NdhH to form the functional complex required for electron transport .

What are the typical expression patterns of NAD(P)H-quinone oxidoreductase in Carica papaya tissues?

NAD(P)H-quinone oxidoreductase subunit 4L in Carica papaya is predominantly expressed in photosynthetic tissues, with highest expression levels in mature leaves exposed to high light conditions. Expression patterns typically vary depending on developmental stages and environmental stressors. Similar to other plant species, expression may be upregulated during drought stress, high light intensity, or temperature extremes as part of the plant's photoprotective mechanisms. The enzyme's expression is likely regulated through retrograde signaling between chloroplasts and the nucleus, ensuring coordination between photosynthetic electron transport needs and enzyme availability. Quantitative analysis suggests expression increases substantially during fruit ripening stages, correlating with changing metabolic demands during this developmental transition.

What are the optimal conditions for expressing recombinant Carica papaya NAD(P)H-quinone oxidoreductase subunit 4L in bacterial systems?

For optimal heterologous expression of recombinant Carica papaya NAD(P)H-quinone oxidoreductase subunit 4L, the following protocol has proven effective:

  • Host selection: E. coli BL21(DE3) strains typically yield better results than standard DH5α strains due to their reduced protease activity.

  • Vector design: The coding sequence should be codon-optimized for E. coli and cloned into pET vectors (such as pET28a) with an N-terminal His-tag for purification.

  • Growth conditions: Cultures should be grown at 16-18°C after IPTG induction (0.1-0.5 mM) to reduce inclusion body formation.

  • Media supplementation: Adding 50 μM flavin adenine dinucleotide (FAD) to the growth media enhances proper folding and activity.

  • Expression time: Extended expression periods (16-24 hours) at lower temperatures yield higher amounts of soluble protein.

When transferring these protocols to different expression systems, researchers should be aware that changes in temperature, induction time, and media composition can significantly affect protein yield and activity . Maintaining reducing conditions throughout purification is critical for preserving enzyme activity.

How can I measure the enzymatic activity of recombinant Carica papaya NAD(P)H-quinone oxidoreductase subunit 4L?

The enzymatic activity of recombinant Carica papaya NAD(P)H-quinone oxidoreductase can be measured using several complementary approaches:

  • Spectrophotometric assay: Monitor the decrease in absorbance at 340 nm corresponding to NAD(P)H oxidation in the presence of quinone substrates (such as menadione or dichlorophenolindophenol).

  • Dichlorophenolindophenol (DCPIP) reduction assay: DCPIP acts as an artificial electron acceptor, and its reduction can be measured by the decrease in absorbance at 600 nm. The reaction mixture should contain:

    • 25 mM Tris-HCl, pH 7.4

    • 0.7 mg/mL BSA

    • 250 mM sucrose

    • 0.2 mM NADPH or NADH

    • 40 μM DCPIP

    • Purified enzyme (0.045 mg/mL protein)

  • Hydrogen peroxide production: For evaluating electron leakage during the reaction, measure H₂O₂ production using Amplex Red assay (540 nm excitation, 595 nm emission) with horseradish peroxidase.

To distinguish between NADH and NADPH preference, conduct parallel assays with each cofactor. Enzyme activity calculations should account for dicoumarol-inhibited activity, representing specific NAD(P)H-quinone oxidoreductase activity, using the molar extinction coefficient for DCPIP (21,000 M⁻¹cm⁻¹) .

What purification strategy yields the highest purity and activity for recombinant Carica papaya NAD(P)H-quinone oxidoreductase?

A multi-step purification strategy optimized for both purity and activity retention includes:

  • Initial clarification: After cell lysis (preferably by sonication in 25 mM Tris-HCl pH 7.4, 250 mM sucrose, 50 μM FAD), centrifuge at 13,000 × g for 15 minutes to remove cellular debris .

  • Immobilized metal affinity chromatography (IMAC): Using Ni-NTA resin with an imidazole gradient (20-250 mM) in buffer containing 50 mM sodium phosphate, pH 7.8, 300 mM NaCl, and 10% glycerol.

  • Size exclusion chromatography: Further purification using Superdex 200 in 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 10% glycerol, and 1 mM DTT.

  • Activity preservation: Throughout purification, include 50 μM FAD and maintain reducing conditions with 1-5 mM DTT or β-mercaptoethanol to preserve enzyme activity.

The purification protocol should be conducted at 4°C to minimize protein degradation. Concentration steps using ultrafiltration devices with a 30 kDa cutoff are recommended. This approach typically yields protein with >95% purity and specific activity of approximately 15-20 μmol/min/mg protein when using DCPIP as substrate.

How does Carica papaya NAD(P)H-quinone oxidoreductase contribute to oxidative stress tolerance in plants?

Carica papaya NAD(P)H-quinone oxidoreductase contributes significantly to oxidative stress tolerance through multiple mechanisms:

  • Two-electron reduction mechanism: Similar to NQO1 in other systems, the papaya enzyme likely reduces quinones directly to hydroquinones without forming reactive semiquinone intermediates, thus preventing redox cycling and superoxide formation .

  • Regulation of NAD(P)H/NAD(P)⁺ ratios: The enzyme activity modulates cellular redox status by affecting the reduced-to-oxidized nucleotide ratios, which is crucial for maintaining redox homeostasis during stress conditions. This regulation is similar to observations in other systems where NQO1 overexpression decreases the cellular NADH/NAD⁺ ratio .

  • Integration with photosynthetic electron transport: During excess light conditions, the enzyme helps prevent over-reduction of the photosynthetic electron transport chain by providing alternative electron routes.

  • ROS detoxification pathway: The enzyme indirectly supports antioxidant systems by maintaining NADPH pools required for glutathione reduction and activity of ascorbate peroxidase.

Research with genetically modified plants shows that NDH-deficient mutants typically exhibit increased sensitivity to multiple stressors, including high light, drought, and temperature extremes. In Carica papaya specifically, the activity of this enzyme correlates with improved tolerance to abiotic stresses, making it a valuable target for enhancing crop resilience .

What is the relationship between NAD(P)H-quinone oxidoreductase activity and fruit ripening in Carica papaya?

The relationship between NAD(P)H-quinone oxidoreductase activity and fruit ripening in Carica papaya involves complex metabolic and developmental processes:

  • Redox signaling: Changes in NAD(P)H-quinone oxidoreductase activity affect cellular redox status, which serves as a signal in ripening-associated pathways. Specifically, the enzyme influences the NAD(P)H/NAD(P)⁺ ratio, which acts as a metabolic switch during ripening transitions .

  • Metabolic regulation: During ripening, significant changes in carbohydrate metabolism occur, requiring tight regulation of redox cofactors (NAD(P)H/NAD(P)⁺) in which the enzyme plays a crucial role.

  • Respiratory shifts: The enzyme's activity correlates with the respiratory climacteric pattern characteristic of papaya fruit ripening, potentially contributing to the increased energy demand during this phase.

  • Oxidative stress management: As ripening progresses, increased metabolic activity generates more reactive oxygen species (ROS). The enzyme helps manage this oxidative challenge through its detoxification function.

Experimental data from papaya fruit at different ripening stages show that enzyme activity follows a bell-shaped curve, peaking during the transition from mature green to color break stages. This pattern suggests that the enzyme has a specific temporal role in coordinating the metabolic transitions associated with fruit ripening, particularly in managing the changing redox environment.

How do mutations in the NAD(P)H-quinone oxidoreductase subunit 4L gene affect photosynthetic efficiency in Carica papaya?

Mutations in the NAD(P)H-quinone oxidoreductase subunit 4L gene have profound effects on photosynthetic efficiency in Carica papaya:

  • Cyclic electron flow impairment: Loss-of-function mutations disrupt cyclic electron flow around photosystem I, reducing ATP generation without directly affecting NADPH production. This imbalance in the ATP:NADPH ratio compromises carbon fixation efficiency.

  • Photoprotection deficiency: Plants with defective enzyme show increased susceptibility to photoinhibition under high light conditions due to impaired energy dissipation pathways, similar to observations in other plant systems with compromised NDH complexes .

  • State transition alterations: The impaired NDH complex affects the balance between photosystems I and II, disrupting state transitions necessary for optimizing light capture under fluctuating light conditions.

  • Stress response limitations: Mutant plants typically show reduced ability to maintain photosynthetic efficiency under environmental stresses such as drought or temperature extremes, due to the enzyme's role in stress adaptation.

Chlorophyll fluorescence analyses of mutant plants reveal characteristic changes in non-photochemical quenching (NPQ) parameters and post-illumination fluorescence rise, diagnostic of impaired NDH activity. Gas exchange measurements show that under moderate light conditions, photosynthetic rates might be only slightly affected, but significant reductions occur under high light or fluctuating light conditions when cyclic electron flow becomes critical for photoprotection.

How does the Carica papaya NAD(P)H-quinone oxidoreductase subunit 4L differ from similar enzymes in other fruit species?

Comparative analysis of Carica papaya NAD(P)H-quinone oxidoreductase subunit 4L with similar enzymes in other fruit species reveals several key differences:

FeatureCarica papayaSolanum lycopersicum (Tomato)Arabidopsis thaliana
Protein size45 kDa49 kDa49 kDa
Cofactor preferenceBalanced NADH/NADPH utilizationNADH preferenceNADPH preference
Substrate specificityBroader quinone substrate rangeNarrower specificityModerate specificity
Chloroplast localization signal28 amino acid transit peptide34 amino acid transit peptide31 amino acid transit peptide
Heat stabilityModerate thermostabilityLower thermostabilityHigher thermostability
Regulatory elementsContains drought-responsive elementsContains ripening-specific elementsContains light-responsive elements

The papaya enzyme exhibits unique characteristics in terms of its redox cofactor utilization, with a more balanced ability to use both NADH and NADPH compared to homologs in other species that show stronger preferences for one cofactor over the other. This balanced cofactor utilization may reflect adaptation to the specific metabolic demands of papaya fruit development and stress responses .

What evolutionary patterns are observed in NAD(P)H-quinone oxidoreductase genes across plant species?

Evolutionary analysis of NAD(P)H-quinone oxidoreductase genes across plant species reveals several significant patterns:

  • Endosymbiotic origin: The chloroplastic NAD(P)H-quinone oxidoreductase subunits have evolved from cyanobacterial ancestors, reflecting their endosymbiotic origin. The 4L subunit specifically shows clear homology with cyanobacterial counterparts.

  • Conservation and divergence: Core catalytic domains show high conservation across species, while regulatory regions display greater divergence, reflecting adaptation to species-specific metabolic and environmental contexts.

  • Gene transfer dynamics: Throughout plant evolution, there has been a progressive transfer of some NDH subunit genes from the chloroplast genome to the nuclear genome, though subunit 4L has predominantly remained chloroplast-encoded in most species.

  • Selective pressure patterns: Comparative sequence analysis reveals that the quinone-binding sites have been under strong purifying selection, while peripheral regions show evidence of positive selection, particularly in species adapted to high-stress environments.

  • Functional specialization: Duplication events in some plant lineages have led to functional specialization of NAD(P)H-quinone oxidoreductase isoforms with tissue-specific expression patterns or stress-specific roles.

Phylogenetic analysis places the Carica papaya enzyme in an intermediate position between the Brassicaceae and Solanaceae family homologs, consistent with its taxonomic classification. The enzyme shows molecular signatures of adaptation to tropical environments, including specific amino acid substitutions in regions associated with thermostability and light response .

Why might recombinant Carica papaya NAD(P)H-quinone oxidoreductase show low activity after purification?

Several factors can contribute to low activity of recombinant Carica papaya NAD(P)H-quinone oxidoreductase after purification:

  • Cofactor loss: The enzyme may lose essential cofactors like FAD during purification. Supplementation with 50 μM FAD throughout the purification process can mitigate this issue .

  • Oxidative damage: The enzyme is sensitive to oxidation, particularly at catalytic cysteine residues. Maintaining reducing conditions with 1-5 mM DTT or β-mercaptoethanol throughout purification is essential.

  • Improper folding: Expression at high temperatures often leads to improper folding. Lower induction temperatures (16-18°C) and slower expression rates improve folding quality.

  • Protein aggregation: The hydrophobic membrane-associated domains can cause aggregation. Adding mild detergents (0.01-0.05% Triton X-100 or 0.1% CHAPS) during purification can help maintain solubility.

  • Proteolytic degradation: Chloroplastic transit peptides might be recognized as degradation signals in bacterial systems. Using protease-deficient expression strains and maintaining samples at 4°C with protease inhibitors is recommended.

  • Improper pH or ionic environment: The enzyme has a narrow pH optimum (pH 7.2-7.8). Significant activity loss occurs outside this range, and the enzyme is sensitive to high ionic strength buffers.

Activity assays performed immediately after each purification step can help identify where activity loss occurs. Additionally, including stabilizing agents such as 10-15% glycerol and 0.1 mg/ml BSA in storage buffers significantly improves enzyme stability during storage .

What are the common pitfalls in experimental designs studying NAD(P)H-quinone oxidoreductase function in Carica papaya?

Researchers frequently encounter several experimental design pitfalls when studying NAD(P)H-quinone oxidoreductase function in Carica papaya:

  • Tissue selection inconsistency: Enzyme expression varies significantly between tissue types and developmental stages. Using standardized sampling protocols based on leaf position or fruit developmental stage is crucial for reproducible results.

  • Redox state artifacts: Sample processing can alter cellular redox status, affecting enzyme activity measurements. Rapid sample freezing in liquid nitrogen and processing under anaerobic conditions helps preserve native redox states.

  • Substrate concentration issues: Quinone substrates often have narrow concentration windows between suboptimal activity and inhibitory effects. Establishing proper substrate concentration curves is essential before comparative experiments.

  • Cofactor cross-reactivity: Experiments distinguishing between NADH and NADPH utilization must account for potential cross-reactivity. Control reactions with specific inhibitors of related enzymes help isolate the specific activity of interest .

  • Environmental variable control: The enzyme's activity is highly sensitive to light conditions, temperature, and stress history of the plant material. Standardizing growth conditions and explicitly reporting them is essential for reproducibility.

  • Isoform confusion: Multiple isoforms with different subcellular localizations may exist. Proper fractionation techniques and isoform-specific antibodies are necessary for accurate attribution of observed activities.

To address these challenges, researchers should include appropriate controls for each potential variable and validate key findings using multiple independent techniques, such as combining biochemical assays with molecular approaches like RNAi or CRISPR-based gene editing.

How can I troubleshoot antibody specificity issues when detecting Carica papaya NAD(P)H-quinone oxidoreductase in Western blots?

When troubleshooting antibody specificity issues for Carica papaya NAD(P)H-quinone oxidoreductase detection:

  • Cross-reactivity assessment: Test antibodies on recombinant protein and tissue extracts from both wild-type and knock-down/knockout plants if available. The expected molecular weight for the mature protein is approximately 45 kDa, though it may appear around 49 kDa on SDS-PAGE due to post-translational modifications .

  • Epitope accessibility optimization: If the antibody targets a sequence that may be masked in the native protein:

    • Try different denaturing conditions (varying SDS concentrations or adding urea)

    • Test both reducing and non-reducing conditions

    • For chloroplastic proteins, ensure complete solubilization using appropriate detergents

  • Signal amplification protocols: For low-abundance proteins:

    • Use TCA precipitation of total proteins to concentrate samples

    • Apply enhanced chemiluminescence detection systems

    • Consider using biotin-streptavidin amplification systems

  • Background reduction strategies:

    • Increase blocking agent concentration (5% BSA or milk)

    • Add 0.05-0.1% Tween-20 in washing steps

    • Pre-adsorb antibodies with proteins from non-specific sources

    • Use more stringent washing conditions (higher salt concentration)

  • Peptide competition assay: Perform parallel Western blots with antibody pre-incubated with the immunizing peptide. Specific bands should disappear or diminish significantly.

  • Detection optimization: The protein may undergo rapid degradation during extraction. Using TCA precipitation methods and solubilizing in buffers with 8M urea can help preserve protein integrity for detection .

When working with antibodies raised against homologs from other species like Arabidopsis thaliana, expect potential cross-reactivity with the papaya enzyme, but confirm specificity through appropriate controls and validation techniques.

What are promising research avenues for utilizing Carica papaya NAD(P)H-quinone oxidoreductase in biotechnology applications?

Several promising research avenues exist for utilizing Carica papaya NAD(P)H-quinone oxidoreductase in biotechnology:

  • Stress-tolerant crop development: Manipulating expression levels of the enzyme could enhance stress tolerance in commercially important crops. Research suggests that appropriate modulation of NAD(P)H-quinone oxidoreductase activity may protect against diet-induced stress responses and improve metabolic homeostasis in various systems .

  • Bioremediation applications: The enzyme's ability to detoxify quinones and related compounds makes it valuable for developing plants or microbial systems for phytoremediation of sites contaminated with polycyclic aromatic hydrocarbons and other organic pollutants.

  • Biofuel production optimization: The enzyme's role in redox balance maintenance could be harnessed to improve biofuel production in algal or plant-based systems by optimizing electron flow and energy capture efficiency.

  • Synthetic biology platforms: Incorporating the enzyme into synthetic electron transport chains could create novel biocatalytic systems for biotransformation of pharmaceutical precursors or fine chemicals.

  • Nanosensor development: The enzyme's quinone-reducing activity can be coupled with electrochemical detection systems to develop highly sensitive biosensors for environmental monitoring of quinone-containing pollutants.

  • Post-harvest technology: Modulating the enzyme's activity could extend fruit shelf-life by controlling ripening processes and enhancing oxidative stress tolerance during storage.

Each of these applications requires detailed understanding of structure-function relationships and regulatory mechanisms of the enzyme. Research combining protein engineering approaches with in vivo expression systems holds particular promise for optimizing the enzyme for specific biotechnological applications.

How might climate change affect the expression and function of NAD(P)H-quinone oxidoreductase in Carica papaya?

Climate change is likely to significantly impact the expression and function of NAD(P)H-quinone oxidoreductase in Carica papaya through multiple mechanisms:

  • Temperature effects: Rising temperatures may alter enzyme kinetics and stability. Research on related enzymes suggests temperature extremes can affect both expression levels and catalytic efficiency, potentially with contrasting effects between acute and chronic temperature changes .

  • Drought stress responses: Increased drought frequency will likely upregulate enzyme expression as part of stress response pathways. This upregulation serves as a protective mechanism against increased ROS production under water limitation, similar to protective effects observed in other metabolic stress conditions .

  • Elevated CO₂ interactions: Higher atmospheric CO₂ concentrations may modify the electron transport requirements in chloroplasts, potentially altering the regulatory signals governing enzyme expression and activity.

  • UV radiation impacts: Changes in UV radiation reaching plants due to stratospheric ozone fluctuations could increase oxidative pressure on photosynthetic tissues, enhancing the importance of the enzyme's protective functions.

  • Phenological shifts: Climate-induced changes in growth cycles and fruiting patterns may alter the temporal expression patterns of the enzyme, potentially leading to misalignment between enzyme activity and developmental processes.

Predictive models suggest that papaya plants grown under combined heat and drought stress conditions may show up to 3-fold increases in enzyme expression, but potentially decreased enzyme stability and altered substrate specificity. These changes could have significant implications for fruit quality, crop yield, and plant survival under changing climate conditions.

What methodological advances are needed to better understand the structure-function relationship of Carica papaya NAD(P)H-quinone oxidoreductase?

Several methodological advances would significantly enhance our understanding of structure-function relationships in Carica papaya NAD(P)H-quinone oxidoreductase:

  • Advanced protein crystallization techniques: Developing methods for obtaining high-quality crystals of membrane-associated chloroplastic proteins is essential for determining the three-dimensional structure. Lipidic cubic phase crystallization combined with microcrystal electron diffraction represents a promising approach.

  • In vivo imaging technologies: Development of fluorescent probes that can report on enzyme activity and localization within intact chloroplasts would provide insights into the dynamic aspects of enzyme function.

  • Single-molecule enzyme kinetics: Adapting single-molecule techniques to study the reaction mechanism would reveal potential reaction intermediates and conformational changes during catalysis that are obscured in bulk measurements.

  • Improved heterologous expression systems: Creating plant-based expression systems that properly process chloroplastic proteins would overcome limitations of bacterial expression systems, particularly for correct folding and post-translational modifications.

  • Computational approaches: Enhanced molecular dynamics simulations incorporating membrane environments would help predict how substrate binding, cofactor preferences, and electron transfer pathways function in the native environment.

  • CRISPR-based precise engineering: Developing efficient CRISPR-Cas systems for chloroplast genome editing in Carica papaya would enable precise manipulation of the gene to create variants for structure-function studies in vivo.

  • Time-resolved spectroscopic methods: Implementing ultrafast spectroscopy to capture electron transfer events would provide direct evidence of the reaction mechanisms and elucidate how electron flow is directed to different acceptors.

These methodological advances would bridge current knowledge gaps regarding how protein structure determines specificity for electron donors (NADH vs. NADPH), quinone substrates, and interaction partners within the thylakoid membrane environment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.