Recombinant Carica papaya Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant CP47 is synthesized via heterologous expression in E. coli, followed by purification using affinity chromatography (e.g., nickel columns for His-tagged proteins) . Key steps include:

  • Expression: Induction of E. coli cultures to produce the His-tagged protein.

  • Purification: Elution from nickel columns, followed by lyophilization or storage in Tris-based buffers with glycerol .

  • Quality Control: SDS-PAGE analysis to confirm purity .

ParameterSpecification
Storage BufferTris-based buffer, 50% glycerol, pH 8.0
ReconstitutionDeionized water (0.1–1.0 mg/mL), with added glycerol for stability
StabilityAvoid repeated freeze-thaw cycles; store at -20°C/-80°C

Research Findings and Functional Insights

The recombinant CP47 is utilized to study PSII assembly and chlorophyll integration. Critical findings include:

A. Role in PSII Assembly
CP47 integrates into the PSII core complex alongside D1/D2 reaction center proteins and cytochrome b559 . Its assembly depends on auxiliary proteins:

  • PAM68: Binds ribosomes near the SecY translocon to facilitate chlorophyll insertion during translation .

  • FPB1: Cooperates with PAM68 to integrate CP47’s transmembrane domains and large stromal loop .

B. Chlorophyll Binding and Structural Models
CP47 binds 16 chlorophyll a molecules and 4 β-carotene molecules, as inferred from spinach and cyanobacterial models . Structural studies suggest:

  • Chlorophyll Coordination: Histidine residues in transmembrane helices act as axial ligands for chlorophyll .

  • Spectroscopic Properties: Fluorescence quantum yields and absorption spectra align with native CP47 but show minor shifts in Synechocystis models .

Applications in Research

While direct applications of the Carica papaya recombinant CP47 are less documented, its use aligns with broader goals in plant biotechnology and structural biology:

  • PSII Dynamics: Studying photodamage repair and D1 turnover in PSII .

  • Chlorophyll Engineering: Investigating ligand interactions and antenna efficiency .

Comparative Analysis with Other Species

The Carica papaya CP47 shares structural homology with orthologs from other plants, as shown below:

SpeciesUniProt IDKey DivergenceSource
Spinacia oleraceaP04160Identical transmembrane domain organization
Lactuca sativaQ332V1Conserved His residues for chlorophyll binding
Carica papayaB1A961Minor sequence variations in stromal loops

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Carica papaya (Papaya)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
CP47, a component of the photosystem II (PSII) core complex, binds chlorophyll and facilitates the primary light-induced photochemical processes within PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient, which is subsequently utilized for ATP formation.
Database Links

KEGG: cpap:5878371

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does CP47 function within the Photosystem II complex of Carica papaya?

CP47 serves as a proximal antenna protein that collects light energy and funnels it to the reaction center of Photosystem II. Biochemical and structural studies have established that CP47 is tightly associated with the D1/D2 heterodimer that forms the photochemical reaction center of Photosystem II .

The protein performs several critical functions:

  • Light harvesting: The chlorophyll molecules bound to CP47 absorb photons and transfer excitation energy toward the reaction center.

  • Structural support: CP47 provides structural stability to the PSII complex.

  • Binding platform: It serves as a binding site for the extrinsic oxygen evolution enhancer proteins involved in water oxidation.

  • Energy coupling: CP47 facilitates energy coupling between peripheral light-harvesting complexes and the reaction center.

Electron and X-ray diffraction studies have demonstrated that CP47 is positioned adjacent to the reaction center and works in concert with CP43 to form the core antenna system of PSII . This positioning is critical for efficient energy transfer and maintenance of the structural integrity of the photosystem.

What are the optimal methods for expression and purification of recombinant Carica papaya CP47?

Expression and purification of recombinant CP47 from Carica papaya presents several methodological challenges due to its hydrophobic nature and association with chlorophyll molecules. Based on current research approaches, the following methodology is recommended:

Expression System Selection:

  • Agrobacterium-mediated transformation has proven superior to direct transformation methods for expressing photosynthetic proteins in plants, as it reduces transgene copy number and minimizes cosuppression issues .

  • For CP47 specifically, using Agrobacterium tumefaciens strain LBA-4404 has shown promising results in papaya transformation .

Transformation Protocol:

  • Select appropriate explants: Hypocotyls of Carica papaya have demonstrated better transformation efficiency compared to immature zygotic embryos .

  • Co-cultivate explants with Agrobacterium carrying the psbB gene.

  • Use kanamycin (50 mg/L) as a selection marker for transformed cells .

  • Confirm transformation through GUS expression assays.

Protein Purification Strategy:

  • Isolate thylakoid membranes from transformed plant material.

  • Solubilize membranes using mild detergents (typically n-dodecyl-β-D-maltoside).

  • Perform ion exchange chromatography followed by size exclusion chromatography.

  • Stabilize the purified protein with appropriate pigments - Zn-pheophytin a has been demonstrated to be particularly effective for CP47 stabilization .

This approach yields functionally active recombinant CP47 suitable for downstream applications including structural studies and functional assays.

How can researchers effectively stabilize CP47 during isolation and experimental procedures?

Stabilization of CP47 is critical for maintaining its structure and function during isolation and experimental procedures. Research has demonstrated specific approaches that significantly enhance protein stability:

Pigment-Based Stabilization:
Zn-pheophytin a has been identified as particularly effective for stabilizing CP47 against proteolytic degradation, performing better than chlorophyll a at equivalent concentrations . The stabilization effect is concentration-dependent, with optimal results observed at specific pigment:protein ratios.

Stabilizing AgentOptimal ConcentrationRelative EfficiencyNotes
Zn-pheophytin a90-300 pmol per 4.2×10⁷ etioplastsHighMost efficient for CP47 stabilization; efficiency decreases at higher concentrations
Chlorophyll a400-600 pmol per 4.2×10⁷ etioplastsModerateStabilization effect plateaus rather than decreases at higher concentrations

Buffer Optimization:

  • Use glycerol-containing buffers (typically 50% glycerol in Tris-based buffer) for storage .

  • Maintain pH between 6.5-7.5 to minimize denaturation.

  • Include protease inhibitors to prevent degradation.

Storage Conditions:

  • For short-term storage (up to one week), maintain samples at 4°C.

  • For extended storage, keep at -20°C or preferably -80°C.

  • Avoid repeated freeze-thaw cycles as they significantly decrease protein stability .

Practical Implementation:
When designing experiments involving CP47, researchers should incorporate pigments during or immediately after protein isolation to maximize stabilization. The addition of Zn-pheophytin a at the recommended concentrations can increase experimental reproducibility and protein yield significantly.

What are the critical factors affecting Agrobacterium-mediated transformation efficiency for expressing recombinant CP47 in papaya?

Agrobacterium-mediated transformation for expressing recombinant CP47 in papaya is influenced by multiple factors that researchers must optimize for maximum efficiency. Based on comprehensive analysis of transformation protocols, the following critical parameters have been identified:

Explant Selection and Preparation:
Comparative studies have demonstrated that hypocotyls from Carica papaya cv. Shahi consistently yield higher transformation efficiency compared to other explant types or cultivars . The following table summarizes transformation efficiencies across different explant types:

Explant TypeCultivarTransformation EfficiencyRegeneration Rate
HypocotylsC. papaya cv. ShahiHighMaximum
HypocotylsC. papaya cv. RanchiModerateModerate
Immature zygotic embryosC. papaya cv. ShahiModerateModerate
Immature zygotic embryosC. papaya cv. RanchiLowLow

Agrobacterium Strain Selection:
LBA-4404 has demonstrated superior performance for papaya transformation compared to other common strains like GV3111 . When using this strain, researchers should:

  • Maintain bacterial culture in log phase (OD₆₀₀ = 0.6-0.8) for co-cultivation

  • Include acetosyringone (100-200 μM) in co-cultivation medium to induce virulence genes

  • Optimize co-cultivation period (typically 48-72 hours) based on explant viability

Selection Strategy:
Implementing an effective selection strategy is critical for identifying transformed cells:

  • Use 50 mg/L kanamycin as the selection agent for transformed cells expressing the kanamycin resistance gene

  • Apply selection pressure gradually to minimize stress on transformed cells

  • Verify transformation through histochemical GUS assays and molecular confirmation (PCR, Southern blot)

Regeneration Protocol Optimization:
For successful regeneration of transformed plants expressing CP47:

  • Develop a two-phase regeneration protocol: callus induction followed by shoot induction

  • Supplement media with appropriate plant growth regulators (auxins and cytokinins)

  • Carefully monitor and control phenolic compound production, which can inhibit regeneration

By systematically optimizing these parameters, researchers can achieve transformation efficiencies suitable for recombinant CP47 expression studies in papaya.

How do structural modifications of CP47 impact energy transfer efficiency within Photosystem II?

The structure-function relationship of CP47 is central to understanding energy transfer dynamics within Photosystem II. Research has established that specific structural elements and modifications significantly impact energy transfer efficiency:

Chlorophyll Binding Sites:
CP47 contains approximately 16 chlorophyll a binding sites that are critical for light harvesting and energy transfer. Mutations affecting these binding sites have demonstrated that:

  • Chlorophylls bound to the protein's peripheral regions primarily serve in light harvesting

  • Chlorophylls positioned closer to the reaction center facilitate directed energy transfer

  • The spatial arrangement of chlorophylls creates energy transfer pathways with varying efficiencies

Transmembrane Helix Modifications:
CP47 contains six transmembrane helices that position the protein within the thylakoid membrane. Structural studies have revealed that:

  • Modifications to helices IV and V most significantly disrupt energy transfer, as these helices position critical chlorophyll molecules

  • Helix I and II modifications primarily affect structural stability rather than energy transfer directly

  • The large extrinsic loop E connecting helices V and VI is essential for interaction with oxygen-evolving complex proteins

Post-Translational Modifications:
Research indicates that CP47 undergoes several post-translational modifications that can modulate its function:

  • Phosphorylation of threonine residues in the N-terminal region affects protein-protein interactions and energy coupling

  • Oxidative modifications during photoinhibition alter energy transfer pathways

  • Proteolytic processing under stress conditions can modify the functional properties of the protein

Methodological Approaches to Study Structure-Function Relationships:
To investigate how structural modifications impact energy transfer efficiency, researchers should employ:

  • Site-directed mutagenesis targeting specific amino acid residues

  • Time-resolved fluorescence spectroscopy to measure energy transfer kinetics

  • Single-molecule techniques to observe heterogeneity in energy transfer properties

  • Computational modeling to predict energy transfer pathways based on structural data

By correlating structural modifications with changes in energy transfer efficiency, researchers can develop a comprehensive understanding of CP47's role in photosynthetic light harvesting and energy conversion.

What are the recommended protocols for investigating interactions between recombinant CP47 and other Photosystem II components?

Investigating protein-protein interactions involving recombinant CP47 requires specialized approaches that account for its membrane-embedded nature and complex association with other Photosystem II components. The following methodological framework is recommended:

Co-Immunoprecipitation Studies:

  • Generate antibodies specific to recombinant Carica papaya CP47

  • Solubilize thylakoid membranes using mild detergents (0.5-1% n-dodecyl-β-D-maltoside)

  • Perform immunoprecipitation with anti-CP47 antibodies

  • Analyze co-precipitated proteins using mass spectrometry to identify interaction partners

Cross-Linking Coupled with Mass Spectrometry:
This approach enables identification of specific interaction sites between CP47 and other PSII components:

  • Apply chemical cross-linkers (e.g., DSP, BS3) to intact PSII complexes

  • Digest cross-linked complexes with proteases

  • Analyze cross-linked peptides using LC-MS/MS

  • Map interaction sites based on cross-linked peptide identification

Surface Plasmon Resonance (SPR):
For quantitative assessment of binding kinetics:

  • Immobilize purified recombinant CP47 on a sensor chip

  • Flow potential interaction partners (e.g., D1, CP43, extrinsic proteins) over the immobilized CP47

  • Measure association and dissociation rates

  • Calculate binding affinities (KD values)

Förster Resonance Energy Transfer (FRET):
To study proximity and dynamic interactions:

  • Label recombinant CP47 and potential interaction partners with compatible fluorophores

  • Reconstitute proteins into liposomes or nanodiscs

  • Measure FRET efficiency as an indicator of protein-protein proximity

  • Perform FRET under various conditions to assess interaction dynamics

Cryo-Electron Microscopy:
For structural characterization of protein complexes:

  • Purify PSII complexes containing recombinant CP47

  • Prepare samples for cryo-EM imaging

  • Collect and process image data

  • Generate 3D reconstructions of protein complexes

When implementing these methods, researchers should establish appropriate controls to verify the specificity of observed interactions and ensure that the recombinant protein maintains native-like structure and function.

How can researchers address common issues in recombinant CP47 expression and functionality?

Researchers working with recombinant CP47 frequently encounter challenges that can compromise experimental outcomes. The following troubleshooting guide addresses common issues and provides evidence-based solutions:

Challenge: Low Transformation Efficiency

Potential CauseSolution ApproachEffectiveness
Suboptimal Agrobacterium strainSwitch to LBA-4404 strain, which has demonstrated superior performance for papaya transformation High
Inappropriate explant selectionUse hypocotyls from C. papaya cv. Shahi, which show higher transformation rates than immature embryos High
Ineffective selection pressureApply 50 mg/L kanamycin gradually after co-cultivation period Moderate
Phenolic compound accumulationAdd antioxidants (e.g., ascorbic acid, PVP) to co-cultivation mediumModerate

Challenge: Protein Instability During Purification

Potential CauseSolution ApproachEffectiveness
Proteolytic degradationAdd Zn-pheophytin a (90-300 pmol per 4.2×10⁷ etioplasts) during isolation High
Pigment lossSupplement with appropriate pigment concentrations during purificationHigh
Oxidative damageInclude reducing agents (e.g., DTT, β-mercaptoethanol) in purification buffersModerate
Thermal instabilityMaintain all procedures at 4°C and use 50% glycerol in storage buffer High

Challenge: Non-Functional Recombinant Protein

Potential CauseSolution ApproachEffectiveness
Improper foldingExpress protein with chlorophyll or Zn-pheophytin a to facilitate proper folding High
Incorrect post-translational modificationsUse plant-based expression systems rather than bacterial systemsHigh
Altered protein-pigment interactionsReconstitute with pigments after purificationModerate
Truncated protein productionVerify full-length expression using Western blot with N and C-terminal antibodiesModerate

Methodological Verification:
When troubleshooting recombinant CP47 expression and functionality issues, researchers should implement the following verification steps:

  • Confirm transformation using both antibiotic selection and GUS histochemical assays

  • Verify protein expression using Western blot with antibodies specific to CP47

  • Assess protein-pigment interactions using absorption spectroscopy

  • Evaluate energy transfer capability using time-resolved fluorescence measurements

By systematically addressing these common challenges using evidence-based approaches, researchers can significantly improve the success rate of experiments involving recombinant CP47 from Carica papaya.

What strategies can resolve contradictory data regarding CP47's role in energy transfer?

The scientific literature contains some contradictory findings regarding CP47's precise role in photosynthetic energy transfer. These contradictions often arise from methodological differences, species-specific variations, or differences in experimental conditions. The following strategies can help researchers resolve these contradictions:

Comparative Analysis Across Species:
One source of contradictory data stems from species-specific differences in CP47 structure and function. To address this:

  • Perform sequence alignment analyses comparing Carica papaya CP47 with homologs from other well-studied species

  • Identify conserved vs. variable regions that might explain functional differences

  • Generate chimeric proteins combining domains from different species to isolate functional elements

Standardized Methodological Approach:
To facilitate direct comparison of results:

  • Develop standardized purification protocols that preserve native protein structure

  • Establish consistent measurement conditions for spectroscopic analyses

  • Adopt uniform experimental parameters when measuring energy transfer kinetics

  • Use the same reference points when reporting relative energy transfer efficiencies

Integration of Multiple Technical Approaches:
Contradictions often arise when different techniques highlight different aspects of CP47 function. Resolving these requires:

  • Combining structural studies (X-ray crystallography, cryo-EM) with functional analyses

  • Correlating spectroscopic data with biochemical interaction studies

  • Complementing in vitro studies with in vivo measurements

  • Using computational modeling to reconcile seemingly contradictory experimental results

Systematic Mutation Analysis:
To directly test hypotheses about structure-function relationships:

  • Generate a comprehensive library of site-directed CP47 mutants

  • Evaluate each mutation's impact on both structural integrity and energy transfer function

  • Map critical residues that affect energy transfer pathways

  • Correlate mutational effects with existing structural models

Resolution Table for Common Contradictions:

Contradictory FindingPossible ExplanationResolution Approach
Varying reports of chlorophyll content in CP47Different isolation methods causing pigment lossStandardize pigment quantification methods and use Zn-pheophytin a to stabilize
Discrepancies in energy transfer ratesMeasurement under different biochemical conditionsPerform comparative measurements under identical conditions
Conflicting data on interaction partnersSpecies-specific differences in protein-protein interactionsUse cross-species approaches and validate with multiple interaction assays
Varying reports of CP47 stabilityDifferent stabilization methods during isolationAdopt standardized stabilization protocols using optimal pigment concentrations

By systematically implementing these approaches, researchers can resolve contradictions in the literature and develop a more consistent understanding of CP47's role in photosynthetic energy transfer.

What are the emerging techniques that will advance our understanding of CP47 structure and function?

The study of CP47 structure and function is poised to benefit from several emerging techniques and approaches that promise to provide deeper insights into this critical photosynthetic protein:

Cryo-Electron Microscopy Advancements:
Recent improvements in cryo-EM resolution now enable visualization of protein structures at near-atomic resolution, offering several advantages for CP47 research:

  • Visualization of protein-pigment interactions without crystallization artifacts

  • Analysis of conformational heterogeneity within Photosystem II populations

  • Structural determination of CP47 under physiologically relevant conditions

  • Mapping of dynamic structural changes during photosynthetic energy transfer

Single-Molecule Spectroscopy:
This approach allows researchers to bypass ensemble averaging and observe individual CP47 molecules:

  • Detection of rare or transient conformational states

  • Measurement of energy transfer pathways in individual protein complexes

  • Correlation of structural variations with functional differences

  • Real-time observation of dynamic processes during energy transfer

Computational Approaches:
Advanced computational methods are increasingly valuable for CP47 research:

  • Molecular dynamics simulations to model pigment-protein interactions

  • Quantum mechanical calculations to predict energy transfer pathways

  • Machine learning approaches to identify structural determinants of function

  • Integration of computational models with experimental data for improved accuracy

Multi-dimensional Spectroscopy:
These techniques provide unprecedented insights into energy transfer dynamics:

  • 2D electronic spectroscopy to map energy coupling between chlorophylls

  • Transient absorption spectroscopy with femtosecond resolution

  • Correlation of spectral features with structural elements

  • Direct observation of quantum coherence effects in energy transfer

CRISPR-Based Approaches:
Genome editing technologies enable more precise manipulation of the psbB gene:

  • Introduction of specific mutations with minimal off-target effects

  • Creation of tagged versions of CP47 for in vivo tracking

  • Development of conditional expression systems for functional studies

  • Generation of specific reporter systems linked to CP47 function

How might engineered variants of CP47 contribute to improved photosynthetic efficiency?

Engineering CP47 variants offers promising avenues for enhancing photosynthetic efficiency, with potential applications in both basic research and applied biotechnology. Based on current understanding of structure-function relationships, several strategic approaches appear particularly promising:

Optimizing Light-Harvesting Capacity:
Modifications to chlorophyll-binding sites could enhance light capture across the photosynthetically active spectrum:

  • Engineering chlorophyll-binding pockets to accommodate modified pigments with expanded absorption profiles

  • Adjusting the spatial arrangement of chlorophylls to optimize excitation energy transfer

  • Introducing binding sites for additional pigments to expand the absorption cross-section

Enhancing Energy Transfer Efficiency:
Targeted modifications could reduce energy losses during transfer:

  • Optimizing inter-pigment distances to maximize electronic coupling

  • Engineering the protein environment to reduce non-radiative energy dissipation

  • Modifying specific amino acids that influence the orientation of chlorophyll transition dipoles

Improving Stress Resistance:
CP47 variants with enhanced stability could maintain function under adverse conditions:

  • Introducing stabilizing interactions that maintain structural integrity during temperature fluctuations

  • Engineering variants less susceptible to photodamage during high light exposure

  • Modifying sites vulnerable to reactive oxygen species to enhance oxidative stress resistance

Methodological Approaches for Engineering CP47 Variants:

Engineering ApproachTechnical StrategyPotential Impact
Rational designStructure-guided mutagenesis of specific amino acids based on mechanistic understandingModerate to high, depending on structural knowledge
Directed evolutionSelection for improved function using random mutagenesis and screeningHigh potential for discovering unexpected beneficial mutations
Domain swappingReplacing regions with corresponding segments from species with desired traitsUseful for transferring advantageous properties between species
Computational designAlgorithm-guided protein engineering based on energy calculationsPromising for optimizing complex interaction networks

Implementation Pathway:
To successfully develop and deploy engineered CP47 variants:

  • Establish high-throughput screening systems to evaluate variant performance

  • Use Agrobacterium-mediated transformation with optimized protocols for efficient integration

  • Evaluate variants in progressively more complex systems: in vitro → isolated chloroplasts → whole plants

  • Assess both immediate functional improvements and long-term stability

The development of engineered CP47 variants represents a promising frontier in photosynthesis research, with potential applications ranging from improved crop productivity to bio-inspired artificial photosynthetic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.