Recombinant Carica papaya Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us for preferential development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Carica papaya (Papaya)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) functions as a light-driven water:plastoquinone oxidoreductase. It harnesses light energy to extract electrons from H₂O, generating O₂ and a proton gradient crucial for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain that converts light excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several downstream electron acceptors.
Database Links

KEGG: cpap:5878403

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the gene structure of psbA in Carica papaya?

The psbA gene encodes the Photosystem Q(B) protein (D1 protein) in Carica papaya. This gene is highly conserved across plant species and is located in the chloroplast genome. According to database information, the gene synonyms include "psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B) protein" with the UniProt ID: B1A915 .

What are the optimal expression systems for producing Recombinant Carica papaya Photosystem Q(B) protein?

E. coli expression systems have proven effective for producing recombinant Photosystem Q(B) protein from Carica papaya. The recommended methodology includes:

  • Construct design: The full-length protein (1-344 amino acids) with an N-terminal His-tag facilitates expression and subsequent purification .

  • Expression conditions: Optimal bacterial growth conditions should be maintained with appropriate induction methods.

  • Protein recovery: The expressed protein is typically recovered in lyophilized powder form .

For successful expression, researchers should consider codon optimization for E. coli and use specialized strains designed for membrane protein expression, as the D1 protein is naturally membrane-associated.

What purification protocols yield the highest purity of Recombinant Photosystem Q(B) protein?

High-purity Photosystem Q(B) protein (>90% as determined by SDS-PAGE) can be achieved through a systematic purification approach :

  • Initial capture: Utilize the His-tag for immobilized metal affinity chromatography (IMAC)

  • Further purification: Size exclusion chromatography to separate intact protein from degradation products

  • Buffer optimization: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 is recommended for storage

When performing reconstitution, researchers should:

  • Centrifuge vials briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol (final concentration 5-50%) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

How can researchers assess the functional integrity of purified Photosystem Q(B) protein?

Multiple complementary approaches can be employed to assess functional integrity:

  • Chlorophyll fluorescence analysis:

    • Measure maximal quantum yield (Fv/Fm)

    • Determine photochemical quantum yield (Y(I))

    • Analyze effective quantum yield (Y(II))

  • Electron transport assays:

    • Oxygen evolution measurements

    • Herbicide binding assays (as many herbicides target the Q(B) binding site)

  • Spectroscopic techniques:

    • Circular dichroism to assess secondary structure

    • Fluorescence spectroscopy to evaluate protein folding

Research shows that functional D1 protein exhibits characteristic fluorescence parameters, which are notably altered in compromised systems. In papaya studies, the lower Fv/Fm and Y(II) in virus-infected leaves indicated potential photodamage, whereas increased non-photochemical quenching (Y(NPQ)) appeared to prevent irreversible PSII center damage .

What proteomics approaches are most effective for studying Photosystem Q(B) protein modifications?

Advanced proteomics techniques have proven valuable for investigating D1 protein modifications:

  • TMT-LCMS analysis: This recently developed approach has successfully identified thousands of proteins in papaya, offering comprehensive proteome coverage. In a ripening study, 3220 proteins were identified with 2818 quantified .

  • Post-translational modification analysis:

    • Phosphorylation site mapping using titanium dioxide enrichment

    • Oxidative modification detection using redox proteomics

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with tagged D1 protein

    • Cross-linking mass spectrometry to identify interaction partners

These approaches have revealed significant insights into photosynthetic protein dynamics. For instance, differential accumulated proteins (DAPs) during papaya ripening showed altered biological functions and diverse subcellular localizations, with significant changes in metabolic pathways including those related to photosynthesis .

What structural features distinguish Carica papaya Photosystem Q(B) protein from other plant species?

The Photosystem Q(B) protein structure is generally conserved across plant species, but subtle species-specific differences can impact function. Key considerations when examining the Carica papaya version include:

  • Transmembrane domain organization: The papaya D1 protein contains multiple transmembrane helices that anchor it within the thylakoid membrane.

  • Binding pocket architecture: The Q(B) binding site structure determines herbicide sensitivity and electron transport efficiency.

  • Species-specific amino acid variations: While the core functional regions are highly conserved, variations in non-critical regions may reflect evolutionary adaptation to different environmental conditions.

Researchers investigating these structural features should consider employing:

  • Homology modeling based on crystal structures from model organisms

  • Molecular dynamics simulations to analyze protein flexibility

  • Site-directed mutagenesis to probe structure-function relationships

How do mutations in the Photosystem Q(B) protein affect its function and stability?

Mutations in the D1 protein can significantly impact photosynthetic efficiency and plant fitness. Research approaches to investigate these effects include:

  • Site-directed mutagenesis:

    • Target specific amino acids in the Q(B) binding pocket

    • Modify residues involved in protein-protein interactions

  • Functional assessment:

    • Electron transport rate measurements

    • Oxygen evolution analysis

    • Chlorophyll fluorescence parameters (Fv/Fm, Y(II), NPQ)

  • Stability analysis:

    • Thermal shift assays to determine protein stability

    • Protein turnover rates using pulse-chase experiments

Studies of papaya photosynthesis under stress conditions provide insights into D1 protein function. For example, virus-infected papaya showed reduced photosynthetic capacity with altered chlorophyll fluorescence parameters, suggesting compromised D1 protein function. Specifically, infected leaves exhibited lower Fv/Fm and Y(II) values, with compensatory increases in Y(NPQ) .

How do environmental stressors impact Photosystem Q(B) protein function in papaya?

Environmental factors significantly affect D1 protein function and turnover. Research methodologies to investigate these effects include:

  • Controlled stress experiments:

    • Temperature stress (high/low)

    • Light stress (high intensity, UV)

    • Drought conditions

    • Pathogen infection models

  • Physiological measurements:

    • Gas exchange parameters (photosynthetic rate, stomatal conductance)

    • Chlorophyll fluorescence (Fv/Fm, Y(II), NPQ)

    • Water use efficiency

Research on virus-infected papaya demonstrates the impact of biotic stress on photosynthetic machinery. PaLCuV-infected plants showed significantly reduced stomatal conductance (78.34%), photosynthesis rate (74.87%), and water use efficiency (82.51%) compared to healthy plants . These changes correlate with altered chlorophyll fluorescence parameters, particularly decreased Fv/Fm and Y(II) values.

What is the relationship between papaya genotype variations and Photosystem Q(B) protein function?

Different papaya genotypes exhibit variations in photosynthetic capacity related to D1 protein function. The "Golden" genotype, characterized by yellowish leaves, shows different photosynthetic properties compared to green-leafed varieties . Research approaches to investigate genotype-specific variations include:

  • Comparative genomics:

    • Sequence analysis of psbA gene across genotypes

    • Identification of single nucleotide polymorphisms

  • Physiological characterization:

    • Photosynthetic capacity measurements

    • Chlorophyll content analysis

    • Growth and yield parameters

  • Proteomic analysis:

    • Differential protein expression between genotypes

    • Post-translational modification patterns

Studies have shown that the Golden papaya genotype, despite producing commercially valuable fruits, exhibits lower growth and yield compared to other genotypes, which may be related to differences in photosynthetic efficiency due to chlorophyll content variations .

How can researchers utilize Recombinant Carica papaya Photosystem Q(B) protein for herbicide resistance studies?

The D1 protein, which contains the binding site for many commercial herbicides, offers an excellent platform for herbicide resistance research:

  • Binding assays:

    • Competitive binding studies with labeled herbicides

    • Isothermal titration calorimetry for binding affinity determination

  • Mutational analysis:

    • Site-directed mutagenesis of key binding pocket residues

    • Expression of mutant proteins for functional testing

  • Structural analysis:

    • Co-crystallization with herbicide molecules

    • Molecular docking simulations

These approaches can provide insights into herbicide resistance mechanisms and guide the development of new herbicide formulations or resistant crop varieties.

What experimental designs are most effective for studying Photosystem Q(B) protein interactions with viral proteins?

Virus-host protein interactions significantly impact photosynthetic functions. Effective experimental designs include:

  • Virus inoculation studies:

    • Single virus infections (PapMV or PRSV)

    • Simultaneous infections (PapMV + PRSV)

    • Sequential infections (PapMV→PRSV or PRSV→PapMV)

  • Molecular interaction analysis:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation with viral proteins

    • Bimolecular fluorescence complementation

  • Physiological impact assessment:

    • Chlorophyll fluorescence parameters

    • Photosynthetic rate measurements

    • Protein expression level analysis

Research on papaya viral infections has demonstrated that different inoculation sequences produce distinct effects on plant physiology. Studies used experimental designs with 48 papaya plants per replicate, divided into six treatment groups of eight plants each . This approach allowed for robust statistical analysis of virus-induced changes in photosynthetic parameters.

How might CRISPR/Cas9 technology be applied to study Photosystem Q(B) protein function in papaya?

CRISPR/Cas9 genome editing offers powerful approaches for D1 protein research:

  • Targeted genetic modifications:

    • Introduction of specific mutations to test structure-function hypotheses

    • Creation of tagged versions for in vivo localization studies

  • Promoter modifications:

    • Alteration of expression levels to assess dosage effects

    • Introduction of inducible promoters for temporal control

  • Knockout/knockdown studies:

    • Analysis of compensatory mechanisms

    • Investigation of alternative isoforms

When designing CRISPR experiments for chloroplast-encoded genes like psbA, researchers must consider the specialized techniques required for plastid transformation, as standard nuclear CRISPR systems do not directly edit the chloroplast genome.

What potential applications exist for comparative studies between Photosystem Q(B) proteins across diverse papaya varieties?

Comparative studies offer insights into evolutionary adaptation and crop improvement:

  • Biodiversity assessment:

    • Sequence analysis across wild and cultivated papaya varieties

    • Correlation with environmental adaptation

  • Performance evaluation:

    • Photosynthetic efficiency under different conditions

    • Stress tolerance profiles

  • Biotechnological applications:

    • Identification of superior variants for crop improvement

    • Development of molecular markers for breeding programs

Studies comparing the Golden papaya genotype with green-leafed varieties have already revealed significant differences in photosynthetic capacity related to chlorophyll content . Expanding these comparisons to more diverse genotypes could identify valuable traits for crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.