Recombinant Carpobrotus chilensis Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this is for your reference and you are welcome to use another concentration.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Carpobrotus chilensis (Sea fig) (Mesembryanthemum chilense)
Target Names
ycf4
Target Protein Sequence
MNWRSKRIWIELITGSRKISNFCWAFILFLGSLGFLLVGISSYLGRNLISLFPPQQILFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRF LIKDIQSIRIELKEGIYTRRVLYLEIRGQGAIPLTRTDDNLTPREIEQKAAELAYFLRIP IEVF
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its fundamental role in photosynthesis?

Ycf4 (hypothetical open reading frame 4) is a chloroplast-encoded protein essential for photosystem I (PSI) assembly in photosynthetic organisms. Research has shown that Ycf4 is critical for photoautotrophic growth in various plant species. Complete deletion of the YCF4 gene in tobacco resulted in plants unable to survive photoautotrophically, with growth severely hampered without external carbon supply . This protein is highly conserved from cyanobacteria to higher plants, indicating its fundamental importance in photosynthesis .

Functionally, Ycf4 is not directly involved in photosystem subunit synthesis but rather in the assembly of the PSI complex . The protein contains two putative transmembrane α-helices in its N-terminal portion and is stably associated with thylakoid membranes . When localized on thylakoid membranes, Ycf4 is not stably associated with the PSI complex itself but appears to be part of a separate large complex that facilitates PSI assembly .

How do researchers determine the essentiality of Ycf4 for photosynthesis across different species?

Determining Ycf4 essentiality involves systematic gene knockout studies followed by phenotypic analysis. The methodology typically includes:

  • Complete gene disruption: Using techniques like biolistic transformation with selectable marker cassettes (e.g., aadA) to replace the entire YCF4 gene sequence .

  • Confirmation of homoplasmy: Through PCR and Southern blot analysis to verify complete replacement of all copies of the plastid gene .

  • Phenotypic characterization: Assessment of:

    • Growth on media with/without carbon sources

    • Chlorophyll fluorescence measurements

    • Photosynthetic activity measurements

  • Comparative analysis: Studies across species reveal varying degrees of dependency:

    • In Chlamydomonas reinhardtii, Ycf4-deficient mutants cannot grow photoautotrophically

    • In tobacco, complete Ycf4 knockout plants are unable to survive photoautotrophically

    • In cyanobacteria, Ycf4 mutants can maintain photoautotrophic growth, albeit with altered pigment composition

The conflicting results between studies are often resolved by examining the extent of the deletion. For example, in tobacco, partial knockout (deletion of only 93 of 184 amino acids from the N-terminus) allowed photoautotrophic growth, while complete deletion prevented it .

What methodologies are most effective for producing recombinant Ycf4 protein?

Based on current research protocols, the most effective methods for producing recombinant Ycf4 include:

  • Expression system selection: E. coli is the predominant expression system for Ycf4 recombinant production, as demonstrated in multiple studies .

  • Purification strategies:

    • Affinity tags: N-terminal His-tagging is commonly employed for efficient purification

    • Buffer composition: Tris/PBS-based buffers with 6% trehalose at pH 8.0 provide optimal stability

    • Storage conditions: Lyophilized preparations or solutions with 50% glycerol stored at -20°C/-80°C maintain protein integrity

  • Reconstitution protocol:

    • Centrifugation before opening to ensure all material is at the bottom

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol for long-term storage

  • Quality control methods:

    • SDS-PAGE analysis to confirm >90% purity

    • Avoiding repeated freeze-thaw cycles

    • Storing working aliquots at 4°C for up to one week

This methodological approach has successfully yielded functional recombinant Ycf4 proteins from various species including Carpobrotus chilensis, Solanum lycopersicum, and Anthoceros formosae .

How can researchers analyze protein-protein interactions involving Ycf4?

Several complementary approaches can be used to analyze Ycf4 interactions:

  • In silico protein-protein interaction studies:

    • Computational modeling of full-length Ycf4 and truncated versions to identify key interaction domains

    • Analysis of C-terminal (91 aa) and N-terminal (93 aa) segments to determine critical interaction interfaces

  • Biochemical approaches:

    • Co-immunoprecipitation: Using antibodies against Ycf4 to isolate interaction partners

    • Tandem affinity purification (TAP): As demonstrated with TAP-tagged Ycf4 in C. reinhardtii to isolate stable Ycf4-containing complexes

    • Sucrose gradient ultracentrifugation: For separation of complexes of different sizes

    • Ion exchange chromatography: For further purification of Ycf4-containing complexes

  • Identification methods:

    • Mass spectrometry (LC-MS/MS): For identification of proteins co-purifying with Ycf4

    • Immunoblotting: Using specific antibodies to confirm the presence of suspected interaction partners

  • Visualization techniques:

    • Transmission electron microscopy (TEM): For structural analysis of purified Ycf4-containing complexes

    • Single-particle analysis: To determine the dimensions and architecture of large Ycf4-containing assemblies

Research has shown that Ycf4 forms part of a large complex (>1500 kD) that contains PSI subunits and other proteins such as COP2 . These interactions are essential for understanding Ycf4's role in PSI assembly.

How can researchers effectively generate and confirm Ycf4 knockout mutants?

The generation of valid Ycf4 knockout mutants requires careful methodological consideration:

  • Knockout strategy design:

    • Complete versus partial deletion: For conclusive results, researchers should target the entire coding sequence (184 amino acids)

    • Flanking sequence selection: Design transformation vectors with appropriate flanking regions to ensure specificity (e.g., using ycf10 as right border and psaI as left border sequences)

    • Selectable marker choice: Commonly, the aadA gene (conferring spectinomycin resistance) is used

  • Transformation methods:

    • Biolistic transformation: Gold particle bombardment is the established method for chloroplast transformation

    • Selection protocol: Culture bombarded tissue on medium containing spectinomycin (e.g., 500 mg/L)

  • Confirmation of homoplasmy:

    • PCR analysis: Using primers flanking the integration site

    • Southern blot analysis: To confirm complete replacement of all wild-type copies

    • Multiple rounds of selection: Repeated cycles of selection are necessary to achieve homoplasmy

  • Phenotypic verification:

    • Growth assessment: Testing growth on media with varied carbon source concentrations

    • Pigment analysis: Monitoring chlorophyll content and photosynthetic capacity

    • Ultrastructural studies: TEM analysis of chloroplast structure

What explains the conflicting data regarding Ycf4 essentiality across different studies?

The apparent contradiction in research findings about Ycf4 essentiality can be systematically analyzed:

  • Extent of gene deletion:

    • Complete deletion: Studies removing the entire Ycf4 coding sequence (184 amino acids) found it essential for photoautotrophic growth in tobacco

    • Partial deletion: Research deleting only 93 amino acids from the N-terminus (leaving the C-terminal 91 amino acids intact) reported non-essentiality

  • Species-specific differences:

    • In Chlamydomonas reinhardtii, Ycf4 is essential for PSI assembly and photoautotrophic growth

    • In cyanobacteria, Ycf4 mutants can maintain photoautotrophic growth but with altered pigment composition

    • In tobacco, complete knockout prevents photoautotrophic growth

  • Functional redundancy:

    • Cyanobacteria may possess alternative assembly factors that can partially compensate for Ycf4 loss

    • Higher plants appear to have stricter dependence on Ycf4 for PSI assembly

  • Methodological differences:

    • Growth conditions: Variations in light intensity, temperature, and carbon source concentration

    • Assessment criteria: Different parameters for evaluating photosynthetic competence

The critical insight from recent research is that the C-terminal region of Ycf4 plays a decisive role in protein-protein interactions essential for photosynthesis . This explains why partial deletions preserving this region produce different phenotypes compared to complete gene removal.

How does Ycf4 contribute to photosystem assembly beyond its structural role?

Recent research has uncovered multifaceted roles for Ycf4 beyond its classical function as a PSI assembly factor:

  • Transcriptional regulation:

    • Transcriptome analysis of Ycf4-deficient plants revealed altered expression patterns of photosynthetic genes

    • Specifically, transcriptome levels of rbcL (RuBisCO large subunit), LHC (Light-Harvesting Complex), and ATP Synthase genes (atpB and atpL) were decreased in Ycf4 knockout plants

  • Chloroplast structural maintenance:

    • TEM studies showed significant structural anomalies in chloroplasts of Ycf4 mutants

    • These include differences in shape (spherical rather than oblong), size (smaller), and disorganized thylakoid membranes with vesicular structures

  • Protein complex stabilization:

    • Ycf4 forms part of a large complex (>1500 kD) that may serve as a platform for PSI assembly

    • Sucrose gradient ultracentrifugation studies showed that Ycf4 does not co-fractionate with PSI but is found in larger complexes

  • Association with diverse proteins:

    • Beyond PSI subunits, Ycf4 interacts with proteins like the retinal-binding protein COP2

    • These interactions suggest broader roles in photosynthetic membrane organization

This multifunctionality explains why complete loss of Ycf4 has more severe consequences than would be expected from impaired PSI assembly alone.

What experimental approaches can researchers use to study Ycf4 function under stress conditions?

To investigate Ycf4 function under stress conditions, researchers can employ these methodological approaches:

  • Temperature stress protocols:

    • Controlled chambers: Use of growth chambers set at different temperatures (e.g., 8.6°C vs. 21°C) to study low-temperature responses

    • Acclimatization period: Gradual temperature changes (e.g., 7 days at 14°C before 8.6°C treatment) to allow physiological adjustment

    • Sampling strategy: Simultaneous sampling at the middle of the photoperiod to control for diurnal variations

  • Physiological measurements:

    • Photosynthetic pigment analysis: Quantification of chlorophyll degradation and xanthophyll de-epoxidation under stress

    • Antioxidant profiling: Measurement of lipophilic antioxidants like α-tocopherol that accumulate during stress response

    • Fluorescence induction kinetics: Assessment of PSI activity in response to stress conditions

  • Comparative approaches:

    • Native vs. introduced populations: In Carpobrotus species, contrasting responses between native and invasive populations can reveal adaptations

    • Wild-type vs. mutant comparison: Analyzing differential responses to stress between Ycf4 mutants and wild-type plants

  • Molecular analysis:

    • Transcriptome analysis: Examining changes in gene expression patterns under stress conditions

    • Protein stability assessment: Using chloramphenicol treatment to block protein synthesis and measure Ycf4 half-life under stress

    • Protein-protein interaction dynamics: Investigating if stress alters the composition of Ycf4-containing complexes

These methodologies are particularly relevant for studying Carpobrotus chilensis Ycf4, as this species shows adaptation to environmental stresses such as chilling, which may involve modifications in photosynthetic apparatus assembly and function .

What are the most promising research directions for understanding Ycf4 function in Carpobrotus chilensis?

Based on current knowledge gaps and research trends, these directions offer significant potential:

  • Comparative functional genomics:

    • Sequence and functional comparison between Ycf4 from C. chilensis and related species like C. edulis

    • Investigation of whether differences in Ycf4 contribute to C. chilensis' adaptation to its ecological niche

    • Alignment of Ycf4 sequences across Aizoaceae family members to identify unique adaptations

  • Structure-function relationship studies:

    • Site-directed mutagenesis targeting conserved residues in the C. chilensis Ycf4 protein

    • Crystallographic or cryo-EM analysis of the C. chilensis Ycf4 complex

    • Functional complementation studies using chimeric Ycf4 proteins

  • Environmental adaptation mechanisms:

    • Analysis of how C. chilensis Ycf4 functions under drought, salinity, and temperature stress

    • Comparison of PSI assembly efficiency in C. chilensis versus less stress-tolerant species

    • Investigation of whether C. chilensis Ycf4 confers enhanced stress tolerance when expressed in other species

  • Biotechnological applications:

    • Exploration of C. chilensis Ycf4 as a tool for enhancing photosynthetic efficiency in crop plants

    • Development of biosensors using the stress-responsive properties of Ycf4

    • Engineering of photosynthetic organisms with modified Ycf4 for improved performance under suboptimal conditions

Understanding the unique properties of C. chilensis Ycf4 could provide valuable insights for enhancing photosynthetic efficiency in plants, particularly under changing environmental conditions.

How can researchers distinguish between direct and indirect effects of Ycf4 deletion?

Distinguishing direct from indirect effects requires sophisticated experimental design:

  • Temporal analysis of phenotypic changes:

    • Pulse-chase protein labeling: To track the fate of newly synthesized photosynthetic proteins

    • Time-course studies: Monitoring changes in transcription, protein accumulation, and physiological parameters following inducible Ycf4 depletion

    • Early vs. late effects: Identifying primary consequences versus secondary adaptations

  • Complementation strategies:

    • Domain-specific complementation: Re-introducing specific regions of Ycf4 (e.g., C-terminal domain) to determine which functions can be restored

    • Cross-species complementation: Testing if Ycf4 from different organisms can restore function in knockout mutants

    • Inducible expression systems: Allowing controlled restoration of Ycf4 function

  • Biochemical dissection:

    • In vitro reconstitution assays: Testing direct biochemical activities of purified Ycf4

    • Protein complex isolation: Comparing composition of photosynthetic complexes with and without Ycf4

    • Interaction mapping: Determining direct binding partners through techniques like crosslinking-mass spectrometry

  • Comparative genomics and transcriptomics:

    • Meta-analysis: Comparing transcriptional changes across multiple studies and species

    • Network analysis: Identifying regulatory hubs that might mediate indirect effects

    • Conditional correlation analysis: Distinguishing causal relationships from associations

These approaches can help distinguish between Ycf4's direct role in PSI assembly and its broader impacts on chloroplast gene expression, membrane organization, and cellular metabolism .

What techniques are most appropriate for studying the structural biology of Ycf4-containing complexes?

Advanced structural biology approaches for Ycf4 complexes include:

  • Electron microscopy techniques:

    • Transmission electron microscopy (TEM): For visualization of purified Ycf4-containing complexes

    • Single-particle analysis: For determining dimensions and architecture of large assemblies (e.g., the 285 × 185 Å particles observed in purified preparations)

    • Cryo-electron microscopy: For high-resolution structural analysis without fixation artifacts

  • Purification strategies for structural studies:

    • Tandem affinity purification: Using TAP-tagged Ycf4 for isolation of intact complexes

    • Sucrose gradient ultracentrifugation: For separation of complexes by size

    • Ion exchange chromatography: For further purification based on charge properties

  • Mass spectrometry approaches:

    • Native mass spectrometry: For determining intact complex composition and stoichiometry

    • Hydrogen-deuterium exchange: For probing solvent accessibility and conformational dynamics

    • Crosslinking mass spectrometry: For mapping interaction interfaces between Ycf4 and its partners

  • Biophysical characterization:

    • Circular dichroism: For secondary structure analysis of purified Ycf4

    • Small-angle X-ray scattering: For low-resolution shape determination in solution

    • Analytical ultracentrifugation: For determining complex size, shape, and heterogeneity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.