Recombinant Cat 5-hydroxytryptamine receptor 1B (HTR1B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Kindly consult your local distributors for precise delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is preferred, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by numerous factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HTR1B; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin receptor 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
Target Protein Sequence
MEETNTHCAPPPPAGSQTGVSQANLSSAPPNCSTEGYIYQDSIALPWKVLLILVLALFTL ATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVV CDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISIS LPPFFWRQAKAEEEVSDCRVNTDHMLYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILK QTPNRTGKRLTRAQLITDSPGSTSSVTSVNSRAPDVPSESGSPVYVNQVKVRVSDALLEK KKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLN SLINPIIYTMSNEDFKQAFHKLIRFKCTG
Uniprot No.

Target Background

Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). It also acts as a receptor for various alkaloids and psychoactive substances. Ligand binding triggers a conformational change that initiates signaling through guanine nucleotide-binding proteins (G proteins), modulating the activity of downstream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Members of the arrestin family inhibit G protein-mediated signaling and facilitate activation of alternative signaling pathways. This receptor regulates the release of 5-hydroxytryptamine, dopamine, and acetylcholine in the brain, thereby influencing neural activity, nociceptive processing, pain perception, mood, and behavior. Furthermore, it plays a role in vasoconstriction of cerebral arteries.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is 5-hydroxytryptamine receptor 1B (HTR1B) and its primary function in neuronal systems?

The 5-hydroxytryptamine receptor 1B (HTR1B), also known as the serotonin 1B receptor, is a G protein-coupled receptor with a molecular mass of approximately 41 kDa . HTR1B plays an essential role in the serotonin system and is widely involved in various brain activities .

Functionally, HTR1B primarily couples to inhibitory G(i)/G(o) proteins and mediates inhibitory neurotransmission by inhibiting adenylyl cyclase activity . This inhibition results in diminished neurotransmitter release, making HTR1B a key regulator of serotonergic signaling . The receptor serves both as an autoreceptor on serotonergic neurons (regulating 5-HT release) and as a heteroreceptor on non-serotonergic neurons (controlling the release of other neurotransmitters) .

The physiological significance of HTR1B extends to regulating the release of multiple neurotransmitters including 5-hydroxytryptamine, dopamine, and acetylcholine in the brain, thereby affecting neural activity, nociceptive processing, pain perception, mood, and behavior . Additionally, HTR1B plays a role in vasoconstriction of cerebral arteries .

How does HTR1B regulate serotonin release and what are its effects on neural circuits?

HTR1B regulates serotonin release through several mechanisms:

  • Direct inhibition mechanism: Upon binding to HTR1B receptors, serotonin inhibits formation of cAMP and downstream cellular responses, resulting in diminished transmitter release .

  • Serotonin transporter regulation: HTR1B can modulate serotonin transporter function, providing an additional mechanism by which HTR1B autoreceptors control extracellular transmitter levels in serotonergic projection regions .

  • Location-dependent effects: Administration of HTR1B receptor agonists like CP-93,129 suppresses 5-HT release in projection areas such as the hippocampus . In the raphe nuclei, the effects can be more complex, with biphasic responses observed with some agonists .

Research using selective knockdown of HTR1B autoreceptors has demonstrated increased extracellular 5-HT levels in response to SSRI administration and induced antidepressant-like phenotypes, highlighting the potential benefit of pharmacological inhibition of these receptors for treating depression .

What experimental models are currently used to study recombinant HTR1B?

Several experimental models are employed to study recombinant HTR1B:

  • Transfected cell lines: Cells previously bearing no 5-HT receptors are transfected with the cDNA of HTR1B, allowing researchers to study potential signal transduction pathways, correlate receptor structure with function, and determine pharmacological properties .

  • Polarized epithelial models: HTR1B receptors transfected into polarized epithelial LLC-PK1 cells exhibit expression on both basolateral and apical membranes, enabling studies of receptor function in different membrane domains .

  • Tissue-specific regulation models: Mouse models with selective knockdown of HTR1B autoreceptors allow for investigations into the functional role of these receptors in specific tissues .

  • Membrane preparations: Crude membrane preparations made from stable recombinant cell lines ensure high-level GPCR surface expression, making them ideal for high-throughput screening of agonists and antagonists .

What are the molecular mechanisms underlying HTR1B signaling and how do they differ from other serotonin receptors?

HTR1B signaling operates through several interconnected molecular mechanisms:

  • G protein coupling: HTR1B is coupled to G(i)/G(o) G alpha proteins. When activated, it mediates inhibitory neurotransmission by inhibiting adenylyl cyclase activity, reducing cAMP formation and subsequent downstream cellular responses .

  • Arrestin-mediated signaling: Arrestin family members can inhibit G protein-mediated signaling and activate alternative signaling pathways when bound to HTR1B .

  • Protein-protein interactions: HTR1B interacts with p11 (S100A10), which increases the receptor's cell surface expression and function .

Unlike some other serotonin receptors, HTR1B signaling is exquisitely sensitive to pertussis toxin, which exclusively implicates Gi/o proteins in signals initiated by this receptor in physiological settings . While the primary signal is inhibition of adenylyl cyclase, HTR1B has also been demonstrated to influence multiple effector systems, including opening of K+ channels, inhibiting Ca2+ currents, stimulating adenylyl cyclase (in some contexts), and inhibiting phospholipase C activation .

This promiscuity in receptor-G protein signaling pathways represents a relatively recent understanding of how single receptor subtypes might link to various second messengers in a single cell system .

How do functional polymorphisms in the HTR1B gene affect receptor expression and signaling?

Research on HTR1B gene polymorphisms has revealed significant effects on receptor expression and function:

  • Regulatory region polymorphisms: Several single nucleotide polymorphisms (SNPs) in the 5′ regulatory region of HTR1B, including rs4140535, rs1778258, rs17273700, rs1228814, rs11568817, and rs130058, can form different haplotypes that influence gene expression levels .

  • Expression regulation: Functional analysis of different haplotypes using dual-luciferase reporter assays in neuronal cell lines has demonstrated that specific sequences within the 5′ regulatory region can have either positive or negative effects on HTR1B expression .

  • Region-specific effects: Sequences between −1587 and −1371 bp, −1149 and −894 bp, −39 and +130 bp, and +130 and +341 bp have been shown to have negative regulatory effects on HTR1B expression .

Genome-wide association studies have demonstrated that HTR1B polymorphisms are closely related to multiple mental and behavioral disorders, though the precise functional mechanisms underlying these associations remain under investigation .

What is the current understanding of HTR1B's role in psychiatric disorders and potential therapeutic targets?

HTR1B has been implicated in several psychiatric and neurological conditions:

  • Depression: Selective knockdown of HTR1B autoreceptors increases extracellular 5-HT levels in response to SSRIs and induces antidepressant-like phenotypes, suggesting that HTR1B antagonism could enhance antidepressant efficacy .

  • Anxiety and aggression: HTR1B regulates behaviors related to anxiety and aggression through its effects on serotonergic and GABAergic neurotransmission .

  • Substance abuse: The receptor has been implicated in reward mechanisms for drugs of abuse, suggesting its potential as a target for addiction treatments .

  • Migraine: HTR1B's role in vasoconstriction of cerebral arteries explains its relevance in migraine pathophysiology and treatment .

The role of HTR1B as both an autoreceptor (on serotonergic neurons) and a heteroreceptor (on non-serotonergic neurons) makes it a complex but potentially valuable therapeutic target. Its inhibitory effect on GABA release in various brain regions, demonstrated by patch clamp recordings in the substantia nigra, suprachiasmatic nuclei, subthalamic nucleus, and globus pallidus, further highlights its widespread influence on inhibitory neurotransmission .

What are the optimal expression systems for generating recombinant HTR1B for in vitro studies?

Several expression systems have proven effective for generating functional recombinant HTR1B:

Mammalian Cell Lines:

  • SK-N-SH neuroblastoma cells: Provide a neuronal environment suitable for studying HTR1B in a context similar to its native expression .

  • HEK-293 cells: Widely used for their high transfection efficiency and robust protein expression .

  • LLC-PK1 cells: Polarized epithelial cells that allow for studies of membrane domain-specific expression and function .

Expression Vector Considerations:

  • Promoterless vectors: Systems like pGL3-Basic (promoterless and enhancerless reporter vector) are effective when studying the influence of the HTR1B regulatory region on expression .

  • Dual reporter systems: Using luciferase-based dual reporter systems enables quantitative assessment of expression levels .

Stable vs. Transient Expression:

  • For signaling studies and pharmacological characterization, stable cell lines expressing consistent levels of HTR1B are preferred to reduce variability .

  • For studies examining regulatory elements, transient transfection allows for rapid testing of multiple constructs .

The choice of expression system should be guided by the specific research question, as each system has distinct advantages for particular applications.

What functional assays are most effective for characterizing HTR1B activity and ligand interactions?

Several complementary assays are employed to thoroughly characterize HTR1B activity:

Signaling Pathway Assays:

  • cAMP inhibition assays: Measure the receptor's canonical ability to inhibit adenylyl cyclase through Gi/o proteins. These assays directly quantify the reduction in forskolin-stimulated cAMP accumulation upon HTR1B activation .

  • GTPγS binding assays: Detect G protein activation by measuring the binding of non-hydrolyzable GTP analogs to G proteins following receptor stimulation .

  • Arrestin recruitment assays: Assess the receptor's ability to engage non-G protein signaling pathways .

Electrophysiological Approaches:

  • Patch clamp recordings: Directly measure electrophysiological changes mediated by HTR1B, such as modulation of K+ and Ca2+ currents or inhibition of GABA-induced inhibitory postsynaptic currents (IPSCs) .

Neurotransmitter Release Assays:

  • Microdialysis: Measures changes in extracellular neurotransmitter concentrations in response to HTR1B modulation in brain slices or in vivo .

  • Neurotransmitter release assays: Measure the effects of HTR1B activation on the release of various neurotransmitters (5-HT, dopamine, acetylcholine, GABA) from synaptosomes or cultured neurons .

Binding Assays:

  • Radioligand binding: Determines the affinity of ligands for HTR1B and quantifies receptor density .

  • Competition binding: Evaluates the relative binding affinity of unlabeled compounds by their ability to displace a radioligand .

The integration of multiple assay types provides a comprehensive profile of HTR1B function and pharmacology.

How can receptor-specific antibodies be validated for HTR1B detection in experimental models?

Rigorous validation of antibodies for HTR1B detection requires a multi-step approach:

Specificity Tests:

  • Western blotting with recombinant protein: Compare blots from cells expressing recombinant HTR1B versus control cells. Antibodies should detect a band of approximately 41 kDa specifically in the expressing cells .

  • Immunohistochemistry controls: Compare staining patterns in tissues known to express high levels of HTR1B (globus pallidus, substantia nigra, dorsal subiculum) versus regions with low expression .

  • Knockout/knockdown controls: Validate antibody specificity by demonstrating reduced or absent signal in samples where HTR1B has been genetically deleted or suppressed .

Cross-reactivity Assessment:

  • Test antibodies against related serotonin receptors, particularly the closely related 5-HT1D receptor, to ensure specificity .

  • For studies across species, confirm cross-reactivity with the target species' HTR1B by sequence alignment and empirical testing .

Functional Correlation:

  • Correlate immunodetection with functional assays or mRNA expression data to confirm that antibody labeling corresponds to functional receptor presence .

Documentation Requirements:

  • Record complete details of antibody source, catalog number, lot number, dilution, and incubation conditions .

  • Document all validation steps performed, including positive and negative controls.

The commercial availability of validated antibodies, such as those targeting specific peptide sequences within HTR1B, provides researchers with tools that have undergone initial validation steps .

What are the key considerations for designing HTR1B gene expression and regulation studies?

Designing robust HTR1B gene expression and regulation studies requires careful consideration of several factors:

Regulatory Region Analysis:

  • Full coverage: Include both proximal and distal regulatory elements. Studies have identified functional sequences from -1587 to +711 bp relative to the transcription start site (TSS, +1) .

  • Sequential truncation approach: Create a series of truncated fragments with a common end point to identify specific regulatory regions. Studies have shown both positive and negative regulatory elements in different regions of the HTR1B 5' regulatory sequence .

Haplotype Consideration:

  • Polymorphism selection: Include functional polymorphisms that have been associated with psychiatric disorders or expression differences .

  • Haplotype construction: Analyze naturally occurring haplotypes rather than individual SNPs, as they better represent the in vivo genetic context .

Cell Model Selection:

  • Use neuronal cell lines (e.g., SK-N-SH) for relevance to the native expression environment .

  • Include non-neuronal cell lines (e.g., HEK-293) as comparative controls to identify tissue-specific regulatory mechanisms .

Quantification Methods:

  • Employ dual-luciferase reporter systems for accurate quantification, normalizing the luciferase signal to an internal control to account for transfection efficiency variations .

  • Supplement reporter assays with direct mRNA quantification (qPCR) and protein expression analysis (Western blotting) .

Statistical Analysis:

  • Verify data distribution (normal vs. non-normal) before selecting appropriate statistical tests .

  • For comparisons between multiple constructs, use ANOVA followed by appropriate post-hoc tests (e.g., Dunnett's T3) .

  • For adjacent fragment comparisons, independent-samples t-tests may be appropriate .

By addressing these considerations, researchers can design experiments that provide meaningful insights into HTR1B regulation and expression patterns.

How do cat HTR1B receptors differ from human and rodent orthologs in terms of structure and function?

While the search results don't provide specific information about cat HTR1B receptors, comparative analysis of serotonin receptors across species reveals several important considerations:

Structural Homology:

  • G protein-coupled receptors like HTR1B typically show high sequence conservation in transmembrane domains across mammalian species .

  • The greatest variability often occurs in the N-terminal extracellular domain and the C-terminal intracellular domain, which may affect ligand binding properties and coupling to signaling pathways, respectively .

Signaling Pathway Conservation:

  • The core signaling mechanism of HTR1B through Gi/o proteins to inhibit adenylyl cyclase is generally conserved across mammals, though coupling efficiency may vary between species .

  • Species differences in the intracellular loops of the receptor may influence the specificity and efficiency of G protein coupling .

Pharmacological Differences:

  • Species-specific differences in the binding pocket can significantly impact the affinity and efficacy of both endogenous ligands and synthetic compounds .

  • When using recombinant cat HTR1B for drug discovery or comparative pharmacology, species-specific validation of ligand binding and functional assays is essential .

Expression Pattern Variations:

  • While the broad distribution of HTR1B in brain regions is generally conserved across mammals, the density and precise localization may vary between species .

  • Studies of receptor autoradiography and immunohistochemistry should be interpreted with attention to potential species differences .

What validation methods should be employed when translating HTR1B research findings across species?

When translating HTR1B research findings between species, particularly to cat models, several validation methods should be employed:

Sequence and Structural Comparison:

  • Perform sequence alignment of HTR1B across target species to identify conserved and divergent regions .

  • Use homology modeling to predict structural differences that might affect ligand binding or signaling .

Pharmacological Profiling:

  • Conduct comparative binding assays using the same panel of ligands across species to identify potential differences in binding affinity or selectivity .

  • Perform functional assays (cAMP inhibition, G protein activation) to compare signaling efficacy and potency across species .

Cross-Species Antibody Validation:

  • Test the cross-reactivity of antibodies against recombinant HTR1B from different species .

  • Perform peptide competition assays to confirm epitope recognition across species .

Tissue Expression Mapping:

  • Compare the distribution pattern of HTR1B in brain regions across species using in situ hybridization or immunohistochemistry .

  • Quantify relative expression levels in homologous brain structures to identify potential species differences .

Functional Conservation Assessment:

  • Use electrophysiological techniques to compare HTR1B-mediated effects on neuronal activity across species .

  • Evaluate the effects of HTR1B agonists and antagonists on neurotransmitter release in tissue preparations from different species .

By employing these validation methods, researchers can determine which aspects of HTR1B biology are conserved across species and which require species-specific consideration, ensuring more accurate translation of findings to the feline system.

What are the most common challenges in expressing functional recombinant HTR1B and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional recombinant HTR1B:

Low Expression Levels:

  • Challenge: G protein-coupled receptors like HTR1B often express at lower levels than soluble proteins.

  • Solution: Optimize codon usage for the host expression system, use strong promoters specific to the host cell, and consider adding signal sequences to enhance membrane targeting .

Improper Membrane Insertion:

  • Challenge: Misfolded receptors may accumulate in the endoplasmic reticulum rather than reaching the plasma membrane.

  • Solution: Express the receptor at lower temperatures (30-32°C instead of 37°C) to allow more time for proper folding, and consider co-expressing chaperone proteins .

Post-translational Modifications:

  • Challenge: Different expression systems may produce varying glycosylation patterns that affect receptor function.

  • Solution: Select expression systems that closely mimic the native post-translational modification environment, such as mammalian cell lines for mammalian GPCRs .

Constitutive Activity:

  • Challenge: Overexpressed receptors may exhibit constitutive activity that complicates interpretation of agonist studies.

  • Solution: Titrate expression levels to find the optimal balance between detection sensitivity and physiological relevance, and include appropriate controls for constitutive activity in functional assays .

Receptor Desensitization:

  • Challenge: Sustained expression of activated receptors can lead to desensitization and internalization.

  • Solution: Use inducible expression systems to control the timing and level of receptor expression, and consider investigating the mechanisms of receptor desensitization as part of the experimental design .

By anticipating and addressing these common challenges, researchers can significantly improve the success rate of recombinant HTR1B expression studies.

How can the specificity of HTR1B-targeted compounds be verified in experimental systems?

Verifying the specificity of compounds targeting HTR1B requires a comprehensive approach using multiple complementary methods:

Binding Specificity Assessment:

  • Receptor panel screening: Test compounds against a panel of related receptors, particularly other 5-HT receptor subtypes, to determine selectivity ratios .

  • Displacement binding curves: Generate full competition curves against a well-characterized radioligand to determine binding affinity (Ki values) .

Functional Selectivity Characterization:

  • Pathway-specific assays: Evaluate activation of different signaling pathways (G protein vs. arrestin) to identify potential biased agonists or antagonists .

  • Concentration-response curves: Generate complete concentration-response relationships for multiple endpoints to compare potency and efficacy across pathways .

Knockout/Knockdown Controls:

  • Genetic validation: Confirm that compound effects are absent or significantly reduced in cells or tissues lacking HTR1B expression .

  • Knockout recovery: Demonstrate that reintroduction of HTR1B restores compound sensitivity in knockout models .

Pharmacological Validation:

  • Known antagonist blockade: Show that effects of putative HTR1B agonists can be blocked by established HTR1B-selective antagonists .

  • Structural analogs: Test a series of structural analogs to establish structure-activity relationships consistent with HTR1B binding .

In vivo Correlation:

  • Physiological responses: Confirm that in vitro findings translate to expected physiological responses in vivo, such as changes in neurotransmitter release or behavioral effects .

  • PET imaging: For suitable compounds, use positron emission tomography with established HTR1B ligands to verify target engagement in vivo .

By implementing this multi-faceted approach, researchers can establish a high degree of confidence in the specificity of HTR1B-targeted compounds and minimize the risk of misattributing effects to HTR1B that actually result from off-target actions.

What emerging technologies are advancing our understanding of HTR1B structure and function?

Several cutting-edge technologies are transforming HTR1B research:

Structural Biology Advances:

  • Cryo-electron microscopy (cryo-EM): Enables visualization of HTR1B in complex with various ligands and signaling partners at near-atomic resolution, providing insights into activation mechanisms and binding pocket dynamics .

  • Molecular dynamics simulations: Allow in silico prediction of receptor conformational changes upon ligand binding and interaction with different effector proteins .

Genetic Engineering Techniques:

  • CRISPR-Cas9 genome editing: Facilitates precise modification of the HTR1B gene to study the effects of specific mutations or polymorphisms in cellular and animal models .

  • Conditional and cell-type-specific knockout models: Enable selective deletion of HTR1B in specific neuronal populations to dissect its role in different brain circuits .

Advanced Imaging Methods:

  • Single-molecule imaging: Tracks individual HTR1B molecules in living cells to study receptor dynamics, dimerization, and interactions with signaling complexes .

  • Optogenetic sensors: Allow real-time visualization of HTR1B-mediated signaling events with high spatial and temporal resolution .

Pharmacological Innovations:

  • Photopharmacology: Development of light-controllable HTR1B ligands enables precise spatiotemporal control of receptor activation in complex tissues .

  • Biased ligand design: Creation of compounds that selectively activate specific HTR1B signaling pathways while avoiding others, potentially reducing side effects .

Integrated Systems Biology Approaches:

  • Single-cell transcriptomics: Reveals cell-type-specific expression patterns of HTR1B and its signaling partners across brain regions .

  • Proteomics of HTR1B signaling complexes: Identifies novel interacting partners that influence receptor function in different cellular contexts .

These technological advances are collectively driving a more comprehensive understanding of HTR1B biology and opening new avenues for therapeutic intervention in related disorders.

What are the current gaps in HTR1B research and potential areas for future investigation?

Despite significant advances in HTR1B research, several important knowledge gaps remain:

Species-Specific Characterization:

  • Limited information exists on the pharmacological properties of HTR1B across species, particularly for companion animals like cats .

  • Future research should systematically compare HTR1B structure, function, and pharmacology across species to facilitate translational studies.

Circuit-Specific Functions:

  • The role of HTR1B as both an autoreceptor and heteroreceptor complicates understanding its net effect on specific neural circuits .

  • Future studies using circuit-specific manipulations could better define how HTR1B modulates information flow in different brain networks.

Signaling Complexity:

  • The full spectrum of HTR1B signaling pathways, particularly non-canonical pathways, remains incompletely characterized .

  • Comprehensive signaling profiling using phosphoproteomics and other high-dimensional approaches could reveal novel signaling mechanisms.

Regulatory Mechanisms:

  • While some regulatory elements in the HTR1B gene have been identified, the complete transcriptional and post-transcriptional regulatory landscape is not fully understood .

  • Epigenetic regulation of HTR1B expression in different physiological and pathological states requires further investigation.

Therapeutic Development:

  • The potential of HTR1B as a therapeutic target for psychiatric disorders beyond migraine remains largely unexplored .

  • Development of highly selective and potentially biased HTR1B ligands could provide novel therapeutic approaches for depression, anxiety, and substance use disorders.

Dynamic Regulation:

  • The mechanisms governing HTR1B trafficking, desensitization, and recycling in response to chronic stimulation or drug treatment need further elucidation .

  • Understanding these processes could reveal new approaches to overcome treatment resistance in HTR1B-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.