Recombinant Cat ATP synthase protein 8 (MT-ATP8)

What is MT-ATP8 and what is its role in mitochondrial function?

MT-ATP8 is a small subunit (typically 55-68 amino acids in mammals) of the mitochondrial ATP synthase complex encoded by the mitochondrial genome. It forms part of the Fo domain that spans the inner mitochondrial membrane and is crucial for proton translocation during ATP synthesis. MT-ATP8 specifically contributes to the assembly and stability of the ATP synthase complex, particularly in the formation of the peripheral stalk and the proper arrangement of the c-ring component of Fo .

Functionally, MT-ATP8 plays a vital role in maintaining the structural integrity of Complex V, which is essential for the final step of oxidative phosphorylation. Mutations in MT-ATP8 can lead to reduced complex V activity and assembly defects, resulting in mitochondrial energy production impairment . Studies have demonstrated that pathogenic mutations in MT-ATP8 can cause improper assembly of the ATP synthase holoenzyme complex .

How does recombinant cat MT-ATP8 compare structurally to MT-ATP8 from other species?

While the search results don't explicitly provide the sequence for cat MT-ATP8, comparative analysis with other mammalian species reveals important conservation patterns. The MT-ATP8 protein exhibits evolutionary conservation, particularly in the C-terminal domain . Based on available sequences for other species, such as the blue whale (Balaenoptera musculus) with 63 amino acids (MPQLDTSTWLLTILSMLLTLFVLFQLKISKHSYSPNPKLVPTKTQKQQTPWNITWTKIYLPLL) and green sea turtle (Chelonia mydas) with 61 amino acids (MPQLNPAPWFMILSSTWLIYTIILQPKILSHLPTNNPTNKNNKINTNSWTWPWTQHSSTNS) , cat MT-ATP8 would likely show similar length and conservation patterns in functional domains.

The C-terminal region appears especially important for function, as research has identified a pathogenic mutation (p.Trp55X) that truncates the protein by removing the final 14 amino acids, confirming the functional importance of this domain .

What expression systems are most effective for producing recombinant cat MT-ATP8?

Based on established protocols for related species, E. coli expression systems are effectively used for recombinant MT-ATP8 production . For optimal expression, consider these methodological approaches:

• Codon optimization: The mitochondrial genetic code differs from the universal code. Recoding the MT-ATP8 sequence for expression in E. coli is essential, as demonstrated in studies with transgenic allotopic expression systems .

• Fusion tags: N-terminal His-tags facilitate purification while maintaining protein functionality, as implemented in commercial recombinant MT-ATP8 preparations .

• Inclusion of mitochondrial targeting sequence (MTS): For functional studies, including an N-terminal MTS (such as from nuclear-encoded ATP5G1) can facilitate proper localization in eukaryotic cells .

Protein expression in E. coli typically yields products requiring solubilization and refolding protocols specific to membrane proteins, with lyophilized powder being a common final formulation, stabilized in Tris/PBS-based buffers with 6% trehalose at pH 8.0 .

What are the recommended protocols for purification and quality control of recombinant cat MT-ATP8?

Purification of recombinant cat MT-ATP8 should follow established membrane protein protocols, with specific adaptations:

• Affinity chromatography: His-tagged MT-ATP8 can be purified using Ni-NTA agarose columns under denaturing conditions followed by on-column refolding .

• Quality control assessments:

  • Purity assessment: SDS-PAGE analysis should demonstrate >90% purity

  • Identity confirmation: Western blotting using anti-His antibodies or MT-ATP8-specific antibodies

  • Functional integrity: Blue native PAGE (BN-PAGE) to assess integration into ATP synthase subcomplexes

• Storage recommendations: Aliquot in Tris/PBS buffer with 5-50% glycerol and store at -20°C/-80°C to avoid repeated freeze-thaw cycles, which can compromise protein integrity . For working solutions, maintain aliquots at 4°C for up to one week .

• Reconstitution protocol: Centrifuge lyophilized protein vials before opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and add glycerol to 5-50% final concentration for long-term storage .

How can researchers effectively measure the functional activity of recombinant cat MT-ATP8?

Assessing MT-ATP8 functionality requires multiple complementary approaches:

• Complex V assembly analysis:

  • Blue Native PAGE (BN-PAGE) followed by immunoblotting to assess incorporation into ATP synthase complexes

  • In-gel activity assay for ATP hydrolysis to detect functional F1-ATPase formation

• Complex V activity measurement:

  • Spectrophotometric assays coupling ATP hydrolysis to NADH oxidation

  • Mitochondrial energy-generating system (MEGS) capacity measurement in cellular models

• Functional complementation studies:

  • Transgene rescue experiments in cells harboring MT-ATP8 mutations

  • Allotopic expression systems to assess functional integration into endogenous complexes

Research indicates that properly functional MT-ATP8 is crucial for holocomplex V assembly, and defects lead to increased amounts of ATP synthase subcomplexes with free F1-ATPase activity .

How can recombinant cat MT-ATP8 be used to study mitochondrial disease mechanisms?

Recombinant MT-ATP8 serves as a valuable tool for investigating mitochondrial disorders through several research approaches:

What experimental approaches are most effective for studying interactions between recombinant cat MT-ATP8 and other ATP synthase subunits?

Several methodological approaches can effectively characterize MT-ATP8's interactions:

• Crosslinking studies combined with mass spectrometry to map interaction sites between MT-ATP8 and neighboring subunits.

• Co-immunoprecipitation assays using tagged recombinant MT-ATP8 to identify binding partners within the ATP synthase complex.

• BN-PAGE combined with second-dimension SDS-PAGE to analyze complex assembly states and subunit composition. This technique has been used to demonstrate that MT-ATP8 mutations lead to defects in holocomplex V formation .

• Transgenic complementation studies using epitope-tagged versions of recombinant MT-ATP8 (such as FLAG-tagged constructs) to track integration into complexes and measure relative abundance compared to endogenous protein .

• Proximity labeling techniques such as BioID or APEX to identify transient or proximal interactions in the cellular context.

What are the common challenges in expressing recombinant cat MT-ATP8 and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant MT-ATP8:

• Protein instability: As a small hydrophobic protein, MT-ATP8 can aggregate or misfold. Recommendations include:

  • Use fusion partners that enhance solubility

  • Express at lower temperatures (16-18°C)

  • Include solubilizing agents during purification

  • Optimize buffer conditions with stabilizing agents like trehalose

• Low expression yields: MT-ATP8's hydrophobic nature can limit expression. Solutions include:

  • Codon optimization for the expression host

  • Use of strong promoters with inducible control

  • Testing multiple expression strains

  • Optimizing induction conditions (temperature, inducer concentration, duration)

• Purification challenges: Membrane proteins are notoriously difficult to purify. Strategies include:

  • Detergent screening to identify optimal solubilization conditions

  • Two-step purification approaches combining affinity chromatography with size exclusion

  • On-column refolding protocols

  • Using mild detergents or amphipols for maintaining native conformation

How can researchers validate that recombinant cat MT-ATP8 maintains proper folding and functionality?

Validating proper folding and functionality requires multiple complementary approaches:

• Structural validation:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Limited proteolysis to probe for properly folded domains

  • Size-exclusion chromatography to detect aggregation states

• Functional integration assessment:

  • Blue Native PAGE to assess complex formation

  • In-gel activity assays for ATP hydrolysis

  • Incorporation into liposomes and proton pumping assays

• Cellular complementation studies:

  • Transfection into MT-ATP8-deficient cells to assess rescue of ATP production

  • Comparison of transgene incorporation rates between wild-type and mutant mitochondria

  • Mitochondrial morphology and membrane potential assessments

How is recombinant cat MT-ATP8 being used in developing mitochondrial gene therapy approaches?

Recombinant MT-ATP8 plays a key role in advancing mitochondrial gene therapy strategies:

• Allotopic expression therapy: Research demonstrates successful nuclear expression of recoded mitochondrial genes with mitochondrial targeting sequences. Studies have generated transgenic models with epitope-tagged, codon-optimized ATP8 genes (oATP8) under CAG promoters, demonstrating successful mitochondrial import and complex integration .

• Mitochondrial targeting optimization: Research with recombinant MT-ATP8 has informed the development of optimal targeting sequences, such as the N-terminal MTS from nuclear-encoded ATP5G1 , with demonstrated efficacy in directing transgene products to mitochondria.

• Integration assessment methodologies: Using tagged recombinant proteins, researchers can quantify the incorporation rate into ATP synthase complexes. Studies show that the apparent ratio of recombinant to endogenous ATP8 can be measured by western blot densitometry, with results indicating approximately twice the amount of transgenic oATP8 compared to endogenous ATP8 in some experimental models .

• Natural variant modeling: Recombinant protein studies help characterize the impact of natural polymorphisms, such as the m.7778 G>T variant in the mitochondrial ATP8 gene, providing insights for targeted therapeutic approaches .

What are the emerging techniques for studying the structure-function relationship of cat MT-ATP8 in ATP synthase complex assembly?

Advanced techniques are revolutionizing our understanding of MT-ATP8's role:

• Cryo-electron microscopy (Cryo-EM) to resolve ATP synthase structures at near-atomic resolution, including the positioning and interactions of MT-ATP8 within the complex.

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic interactions and conformational changes during complex assembly.

• Site-directed crosslinking combined with mass spectrometry to identify specific interaction sites between MT-ATP8 and other subunits.

• Nanoscale respirometry techniques to measure the functional impact of specific MT-ATP8 mutations or modifications on ATP synthesis capacity.

• CRISPR-based approaches for targeted modification of MT-ATP8 to generate cellular models of disease-associated variants.

• Single-molecule techniques to observe the dynamics of ATP synthase assembly and function in real-time, potentially revealing the specific contributions of MT-ATP8.