Recombinant Cat ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Structure and Functional Role of MT-ATP6

MT-ATP6 is a mitochondrial-encoded transmembrane protein integral to ATP synthase’s proton channel. Key structural features include:

FeatureDescription
Gene Length681 base pairs (overlapping with MT-ATP8 in humans)
Protein Weight~24.8 kDa (226 amino acids in humans)
DomainF₀ domain of ATP synthase, forming part of the proton-conducting a/c-ring
Key ResiduesMutations (e.g., m.8993T>G, m.8950G>A) disrupt proton transport and ATP synthesis

In cats, the homolog is presumed to share high structural conservation, given the protein’s evolutionary importance. Recombinant MT-ATP6 production typically involves cloning the mitochondrial gene into expression systems (e.g., E. coli or yeast) to study its assembly and function .

Research Findings from Model Systems

Studies on MT-ATP6 in non-feline systems reveal critical insights:

Functional Impact of Mutations

  • Yeast Models: Mutations like aL173R (equivalent to human aL156R) reduce ATP synthesis by ~90% and impair respiratory growth .

  • Pathogenic Variants: Variants such as m.9025G>A and m.9029A>G disrupt proton flow by altering residues near the a/c-ring interface (e.g., glycine-to-serine substitutions) .

Assembly and Stability

  • BN-PAGE analyses show MT-ATP6 mutations do not significantly affect ATP synthase monomer/dimer ratios but reduce proton coupling efficiency .

  • Subunit a stability depends on interactions with nuclear-encoded subunits (e.g., ATP8) and assembly factors like TMEM70 .

Applications of Recombinant MT-ATP6

While cat-specific studies are lacking, recombinant MT-ATP6 from other species has been used for:

  • Disease Modeling: Yeast strains expressing mutant ATP6 replicate mitochondrial disorders like Leigh syndrome and neuropathy .

  • Drug Screening: Oligomycin (an F₀ inhibitor) and similar compounds are tested using recombinant subunits to assess ATP synthase dysfunction .

  • Structural Studies: Cryo-EM and X-ray crystallography rely on recombinant proteins to resolve ATP synthase mechanisms .

Current Limitations and Research Gaps

  • Species-Specific Data: No peer-reviewed studies explicitly describe recombinant cat MT-ATP6 production or characterization.

  • Functional Overlap: Most insights are extrapolated from human, bovine, or yeast homologs .

  • Technical Challenges: Mitochondrial gene expression in heterologous systems requires optimization to maintain proton channel integrity .

Future Directions

  • CRISPR/Cas9 Models: Engineering feline cell lines with MT-ATP6 mutations could elucidate species-specific pathology.

  • Comparative Studies: Aligning cat MT-ATP6 with known pathogenic variants (e.g., m.8993T>G) may identify conserved disease mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
Full length protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
Target Protein Sequence
MNENLFASFTTPTMMGLPIVILIIMFPSILFPSPNRLINNRLVSLQQWLVQLTSKQMLAI HNHKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRHK TKASLAHFLPQGTPVPLIPMLVVIETISLFIQPMALAVRLTANITAGHLLMHLIGGAALA LMNISTSIALITFTILILLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) synthesizes ATP from ADP in the presence of a proton gradient across the membrane. This gradient is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and may directly participate in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of MT-ATP6 in mitochondrial ATP synthase?

MT-ATP6 encodes subunit a of the mitochondrial ATP synthase (Complex V), which is essential for proton movement across the inner mitochondrial membrane coupled to ATP synthesis. This subunit contains hydrophobic transmembrane domains that form part of the membrane-embedded FO portion of ATP synthase. In cats, the full-length MT-ATP6 protein consists of 226 amino acids and is highly conserved across species, reflecting its critical role in energy production .

The protein functions as a proton channel component, facilitating the flow of protons down their electrochemical gradient to drive the rotary mechanism of ATP synthesis. This fundamental process is conserved across eukaryotes, making various model systems (including yeast and mammalian cell cultures) valuable for studying MT-ATP6 structure-function relationships .

How are recombinant MT-ATP6 proteins typically expressed and purified for research applications?

Recombinant MT-ATP6 proteins are commonly expressed in bacterial systems such as E. coli, as evidenced by the commercial availability of His-tagged cat MT-ATP6 expressed in this system . The highly hydrophobic nature of this membrane protein presents significant challenges for expression and purification.

For optimal expression, researchers typically:

  • Use specialized E. coli strains designed for membrane protein expression

  • Incorporate affinity tags (commonly His-tags) for purification

  • Express the protein at lower temperatures (16-25°C) to enhance proper folding

  • Include detergents during purification to maintain protein solubility

Purification typically involves immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography. The final product is often provided as a lyophilized powder to enhance stability, with purity exceeding 90% as verified by SDS-PAGE .

What experimental models are most effective for studying MT-ATP6 mutations and their functional consequences?

Multiple complementary experimental systems have proven valuable for MT-ATP6 research:

Yeast Models: Saccharomyces cerevisiae provides an excellent system for studying MT-ATP6 mutations because:

  • Its mitochondrial genome can be modified using biolistic particle delivery systems

  • Heteroplasmy is highly unstable, facilitating isolation of homoplasmic strains for specific mtDNA mutations

  • The system allows creation of equivalent mutations to those found in human patients

  • Yeast ATP synthase structure and function are sufficiently conserved to provide relevant insights

Transmitochondrial Cybrids: These cellular models are created by:

  • Fusing enucleated patient-derived cells (containing mitochondria with MT-ATP6 mutations) with ρ0 cells (lacking mtDNA)

  • This generates cell lines containing patient mitochondria in a controlled nuclear background

  • This approach enables assessment of specific mitochondrial mutations without confounding nuclear genetic factors

Patient-Derived Fibroblasts and Muscle Samples: These provide direct access to affected tissues and cells, allowing for:

  • Analysis of ATP synthase structure and function in disease-relevant contexts

  • Correlation of biochemical findings with clinical severity

  • Assessment of heteroplasmy levels and their relationship to cellular dysfunction

How can researchers accurately measure MT-ATP6 mutation heteroplasmy and correlate it with functional outcomes?

Accurate heteroplasmy measurement is critical for MT-ATP6 research, as the mutation load directly influences phenotypic severity. Modern approaches include:

Next-Generation Sequencing (NGS):

  • Provides precise quantification of heteroplasmy levels (to ~1% resolution)

  • Enables detection of heteroplasmy levels from 96-100% in patient samples

  • Allows longitudinal monitoring of heteroplasmy shifts over time

Functional Correlation Methods:

  • Oxygen consumption rate measurement using Seahorse XF analyzers

  • ATP synthesis assays in isolated mitochondria or permeabilized cells

  • Mitochondrial membrane potential assessment using potentiometric dyes

  • Blue Native PAGE for analysis of ATP synthase complex assembly

Research indicates that MT-ATP6 mutation loads typically need to exceed a threshold (often >80-90%) to produce biochemical defects, with clinical manifestations correlating with heteroplasmy levels in relevant tissues .

What approaches can differentiate between pathogenic and non-pathogenic MT-ATP6 variants in research settings?

Distinguishing pathogenic from benign MT-ATP6 variants requires multiple complementary approaches:

Yeast Functional Analysis:

  • Introduction of equivalent mutations in yeast ATP6 gene

  • Assessment of respiratory growth on non-fermentable carbon sources

  • Measurement of mitochondrial ATP synthesis rates

  • Evaluation of ATP synthase assembly and stability

This approach has demonstrated that MT-ATP6 variants like m.8950G>A, m.9025G>A, and m.9029A>G significantly compromise ATP synthase function, while others (m.8843T>C, m.9016A>G, m.9058A>G, m.9139G>A, m.9160T>C) have minimal effects, suggesting they are likely benign or require additional factors to cause pathology .

Conservation Analysis and Structural Modeling:

  • Assessment of evolutionary conservation across species

  • Structural modeling to predict effects on proton channel function

  • Evaluation of amino acid substitution on protein stability and function

Clinical Correlation:

  • Comparison of variant heteroplasmy with disease severity

  • Longitudinal studies of disease progression

  • Brain MRI patterns (particularly basal ganglia involvement in Leigh syndrome)

How can researchers investigate the role of ectopic ATP synthase (eATP synthase) in cancer progression?

The investigation of eATP synthase in cancer cells involves several specialized methodologies:

Spatial Proteomics:

  • Subcellular fractionation to isolate plasma membrane fractions

  • Mass spectrometry analysis to identify ATP synthase subunits in unexpected cellular locations

  • Confirmation with immunofluorescence and flow cytometry to quantify surface expression levels

Trafficking Pathway Analysis:

  • Super-resolution imaging to track ATP synthase movement from mitochondria to cell surface

  • Use of genetic silencing and protein truncation experiments to identify proteins involved in trafficking

  • Real-time fusion assays in live cells to visualize mitochondrial membrane fusion with plasma membrane

Functional Assessment:

  • Measurement of extracellular ATP generation by surface-localized ATP synthase

  • Evaluation of microenvironmental pH changes associated with eATP synthase activity

  • Investigation of eATP synthase as a therapeutic target through antibody-mediated blockade or specific inhibitors

What is the current understanding of MT-ATP6 mutations in mitochondrial disease pathogenesis?

MT-ATP6 mutations are associated with several distinct clinical phenotypes, with Leigh syndrome (LS) being particularly well-documented:

Leigh Syndrome Characteristics:

  • MT-ATP6 variants account for a significant proportion of mtDNA-associated LS cases

  • Predominantly early onset (before age 2), though late-onset cases exist

  • The m.8993T>G mutation specifically correlates with earlier symptom onset and more severe progression

  • Heteroplasmy levels typically exceed 96% in affected patients

  • Brain MRI typically shows bilateral basal ganglia involvement, followed by cerebral atrophy, brainstem and thalamus involvement, and cerebellar atrophy

Truncating Mutations:

  • Recently identified truncating MT-ATP6 mutations represent a distinct class of pathogenic variants

  • These mutations significantly impact ATPase 6 and complex V structure and function

  • Transmitochondrial cybrid studies confirm their pathogenicity

  • Associated with mitochondrial encephalomyopathy

What experimental strategies can assess potential therapeutic approaches for MT-ATP6-related disorders?

Several experimental approaches show promise for evaluating potential therapies:

Heteroplasmy Shifting:

  • Mitochondrially-targeted nucleases (e.g., TALENs, ZFNs, CRISPR-Cas9) to selectively eliminate mutant mtDNA

  • Measurement of wildtype:mutant mtDNA ratio shifts over time

  • Assessment of functional recovery correlating with decreased mutation load

Metabolic Bypass Strategies:

  • Supplementation with metabolic intermediates to bypass Complex V deficiency

  • Assessment of cellular ATP levels and mitochondrial function

  • Evaluation of cell survival under galactose media conditions that force oxidative phosphorylation

Mitochondrial Replacement Therapy Models:

  • Creation of cybrid cell lines with patient nuclear background but healthy donor mitochondria

  • Assessment of ATP synthase function recovery

  • Evaluation of mitochondrial network dynamics and integrity

How can researchers optimize expression systems for recombinant MT-ATP6 protein production?

The hydrophobic nature of MT-ATP6 presents significant expression challenges that can be addressed through several strategies:

E. coli Expression Optimization:

  • Selection of specialized strains (C41, C43) developed for membrane protein expression

  • Use of weak promoters to prevent inclusion body formation

  • Fusion with solubility-enhancing tags (MBP, SUMO) in addition to affinity tags

  • Expression at reduced temperatures (16-18°C) to facilitate proper folding

  • Addition of specific detergents during extraction and purification

Alternative Expression Systems:

  • Cell-free expression systems supplemented with lipids or detergents

  • Baculovirus-infected insect cells for eukaryotic processing

  • Mammalian expression systems for studying properly assembled complexes

Protein Quality Assessment:

  • Circular dichroism to confirm secondary structure

  • Size exclusion chromatography to evaluate oligomeric state

  • Activity assays to confirm functionality of purified protein

What methods can researchers use to study ATP synthase assembly and the specific role of subunit a?

Multiple complementary approaches provide insights into ATP synthase assembly and subunit a function:

Blue Native PAGE and Western Blotting:

  • Allows visualization of fully assembled ATP synthase complex versus subcomplexes

  • Can detect assembly intermediates in mutant cells

  • Enables comparison of assembly efficiency between wildtype and mutant MT-ATP6

Cryo-Electron Microscopy:

  • Provides high-resolution structural information about subunit a position and interactions

  • Enables visualization of how mutations might disrupt proton channeling

  • Allows comparison of ATP synthase structures across species

Proton Translocation Assays:

  • Measurement of proton pumping activity in reconstituted proteoliposomes

  • Assessment of membrane potential generation in isolated mitochondria

  • Direct correlation of specific mutations with proton translocation efficiency

Yeast Genetic Complementation:

  • Expression of wildtype or mutant MT-ATP6 variants in yeast lacking endogenous Atp6

  • Assessment of respiratory growth restoration

  • Measurement of ATP synthesis rates in isolated mitochondria

How should researchers interpret discrepancies between in vitro and in vivo findings for MT-ATP6 mutations?

Discrepancies between experimental systems are common in MT-ATP6 research and require careful interpretation:

System-Specific Factors to Consider:

  • Yeast models may show more dramatic phenotypes than human cells due to differences in compensatory mechanisms

  • Heteroplasmy levels often differ between experimental systems

  • Nuclear genetic background can significantly modify the expression of MT-ATP6 mutations

  • Tissue-specific factors can influence the manifestation of mitochondrial defects

Integration Approaches:

  • Establish clear mutation threshold effects across model systems

  • Compare equivalent mutation loads between systems

  • Use multiple complementary approaches (e.g., yeast, cybrids, and patient samples)

  • Correlate functional deficits with structural predictions and clinical severity

Research demonstrates that mutations causing severe clinical phenotypes typically produce dramatic effects on yeast ATP synthase, while those associated with milder diseases lead to less severe oxidative phosphorylation defects in yeast, validating the comparative approach .

What statistical approaches are most appropriate for analyzing heteroplasmy-dependent phenotypes in MT-ATP6 research?

Analyzing the relationship between heteroplasmy and phenotype requires specialized statistical approaches:

Threshold Effect Modeling:

  • Segmented regression analysis to identify critical heteroplasmy thresholds

  • Incorporation of mixed-effects models to account for inter-individual variability

  • Development of dose-response curves relating mutation load to functional outcomes

Longitudinal Analysis:

  • Application of repeated measures ANOVA for tracking heteroplasmy and phenotype over time

  • Multivariate approaches to incorporate multiple outcome measures

  • Survival analysis techniques for disease progression studies

Control for Confounding Factors:

  • Stratification of analyses by age of onset, specific mutation, and tissue type

  • Incorporation of nuclear genetic modifiers into statistical models

  • Adjustment for mitochondrial DNA copy number variations

Research on MT-ATP6-associated Leigh syndrome demonstrates the value of these approaches in establishing genotype-phenotype correlations and determining prognostic factors .

What emerging technologies hold promise for advancing MT-ATP6 research?

Several cutting-edge technologies are poised to transform MT-ATP6 research:

Single-Cell mtDNA Sequencing:

  • Enables heteroplasmy analysis at single-cell resolution

  • Permits identification of cell-specific thresholds for biochemical defects

  • Facilitates understanding of mutation segregation during development

CRISPR-Based mtDNA Editing:

  • Development of mitochondrially-targeted nucleases for precise genome editing

  • Creation of isogenic cell lines differing only in MT-ATP6 sequence

  • Potential therapeutic applications for reducing mutant load

Advanced Imaging Techniques:

  • Super-resolution microscopy to visualize ATP synthase trafficking and membrane localization

  • Live-cell imaging of ATP synthase assembly process

  • Correlative light and electron microscopy for structural-functional analysis

Organoid Models:

  • Development of patient-derived organoids harboring MT-ATP6 mutations

  • Tissue-specific manifestation of mitochondrial dysfunction

  • Platform for therapeutic testing in complex tissue environments

How might knowledge of ectopic ATP synthase trafficking pathways inform therapeutic strategies?

The discovery that ATP synthase can be trafficked from mitochondria to the cell surface along microtubules via DRP1 and KIF5B interaction offers novel therapeutic possibilities:

Targeting Trafficking Machinery:

  • Inhibition of kinesin family member 5B (KIF5B) to prevent ATP synthase transport to cell surface

  • Modulation of dynamin-related protein 1 (DRP1) activity to alter mitochondrial dynamics and ATP synthase redistribution

  • Disruption of microtubule-dependent transport specifically in cancer cells

Membrane Fusion Intervention:

  • Targeting the fusion process between mitochondrial and plasma membranes

  • Development of small molecules that prevent anchoring of ATP synthase on cell surface

  • Identification of cancer-specific fusion mechanisms for selective targeting

Combination Therapies:

  • Integration of trafficking inhibitors with conventional cancer treatments

  • Dual targeting of intramitochondrial and ectopic ATP synthase

  • Development of biomarkers for patient stratification based on ectopic ATP synthase expression levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.