Recombinant Cat C-X-C chemokine receptor type 4 (CXCR4)

Shipped with Ice Packs
In Stock

Description

Functional Role of CXCR4 in Feline Physiology

CXCR4 is a G protein-coupled receptor (GPCR) that binds stromal cell-derived factor 1 (CXCL12), regulating immune cell trafficking, stem cell homing, and tumor metastasis. In cats, CXCR4 is implicated in:

  • Viral Pathogenesis: Serves as a co-receptor for feline immunodeficiency virus (FIV), analogous to HIV-1’s use of human CXCR4 .

  • Cancer Metastasis: Overexpressed in feline mammary tumors, correlating with aggressive phenotypes .

  • Immune Regulation: Modulates chemotaxis of lymphocytes and neutrophils during inflammation .

3.1. Virology Studies

  • FIV Entry Mechanisms: Recombinant Cat CXCR4 enables in vitro modeling of viral entry inhibition. AMD3100 (CXCR4 antagonist) blocks FIV infection in CrFK cells, highlighting therapeutic potential .

  • Ligand Interactions: Binds CXCL12 with high affinity, facilitating studies on receptor desensitization and internalization .

Comparative Analysis with Other Species

SpeciesCXCR4 FeaturesKey Differences
HumanBinds CXCL12 and HIV-1 gp120; targeted by AMD3100 for stem cell mobilization .N-terminal domain variations affect ligand specificity.
Rat91% amino acid identity with human CXCR4; used in hematopoietic studies .Minor loop residue substitutions alter signaling outputs.
CatCritical for FIV entry; shares 85% homology with human CXCR4 .Unique glycosylation sites impact antibody recognition.

Challenges and Future Directions

  • Expression Limitations: Low yield in E. coli due to transmembrane domain complexity .

  • Therapeutic Potential: CXCR4 antagonists (e.g., AMD3100) show promise in blocking FIV but require optimization for feline pharmacokinetics .

  • Cancer Relevance: Recombinant Cat CXCR4 could model metastasis pathways observed in human triple-negative breast cancer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize fulfilling this request.
Synonyms
CXCR4; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; Fusin; Leukocyte-derived seven transmembrane domain receptor; LESTR; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD antigen CD184
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
Full length protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
Target Protein Sequence
MDGFRIYPSDNYTEDDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLV ILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGKFLCKAVHVIYTVN LYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVRE ADGRYICDRFYPSDSWLVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGYQKRKALK TTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFESTVHKWISITEALAFFHCCLNP ILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Uniprot No.

Target Background

Function
CXCR4 is a receptor for the C-X-C chemokine CXCL12/SDF-1. Signal transduction occurs through increased intracellular calcium ion levels and enhanced MAPK1/MAPK3 activation, and it is involved in AKT signaling. CXCR4 plays a critical role in regulating cell migration, such as during wound healing. It also acts as a receptor for extracellular ubiquitin, leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Furthermore, CXCR4 binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. Its functions include involvement in hematopoiesis, cardiac ventricular septum formation, and gastrointestinal tract vascularization (likely through regulation of vascular branching and/or remodeling in endothelial cells). It also plays an essential role in cerebellar development and may mediate hippocampal neuron survival in the central nervous system.
Gene References Into Functions
  1. CD4+ CD25- cells exhibited decreased susceptibility to FIV binding and entry, correlating with increased surface expression of the FIV coreceptor CXCR4. PMID: 15795282
  2. This research provides direct evidence of a sequential interaction between FIV Env and CD134 and CXCR4. PMID: 16501119
  3. This study examined CD134 and CXCR4 expression on feline T and B cells, dendritic cells, and macrophages, and assessed the kinetics of feline immunodeficiency virus replication. PMID: 18089752
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.

Q&A

What is the basic structure of feline CXCR4 and how does it compare to human CXCR4?

Feline CXCR4, like its human counterpart, belongs to the superfamily of G protein-coupled receptors (GPCRs) that possess seven transmembrane domains. The receptor is constitutively identified and widely expressed by numerous cell types, including hematopoietic cells in the blood and bone marrow, vascular endothelial cells, Langerhans cells, neurons, and neuronal stem cells . The primary structural differences between feline and human CXCR4 occur in the N-terminal domain and certain extracellular loops, though the core signaling machinery remains highly conserved across species. These structural similarities make feline CXCR4 a valuable model for comparative studies of receptor function and pharmaceutical targeting.

What is the primary ligand for CXCR4 and how does the binding mechanism function?

The specific ligand for CXCR4 is CXC motif chemokine 12 (CXCL12), also known as stromal cell-derived factor 1α (SDF-1α). Through binding to CXCL12, which is widely expressed in multiple organs including the colon, liver, brain, lungs, heart, kidney, and spleen, CXCR4 becomes extensively involved in various physiological functions . The binding mechanism involves specific interactions between CXCL12 and the N-terminal domain and extracellular loops of CXCR4. This interaction triggers conformational changes in the receptor, leading to activation of heterotrimeric G proteins and subsequent downstream signaling cascades including the phosphatidylinositol-3-kinase (PI3K) and mitogen-activated protein kinase (MAPK) pathways .

What are the main physiological roles of CXCR4 in normal feline tissues?

In normal feline physiology, CXCR4 performs several critical functions similar to those in other mammalian species. These include:

  • Embryonic hematopoiesis - guiding the development and differentiation of blood cells during embryonic development

  • Organogenesis - contributing to the proper formation and development of organs

  • Vascularization - participating in the formation of blood vessels during development and wound healing

  • Immune surveillance - directing immune cell trafficking and positioning

  • Tissue homeostasis - maintaining normal tissue function and structure

The receptor is essential for normal development as well as adult tissue maintenance and repair processes. Unlike some chemokine receptors with redundant functions, CXCR4 plays unique and non-redundant roles in multiple physiological systems, making it particularly important in comparative mammalian studies.

How does CXCR4 expression correlate with cancer progression and prognosis?

These conflicting results highlight the complexity of CXCR4's role in cancer biology and the need for contextual interpretation based on cancer type, tissue localization of CXCR4 (membrane, cytoplasmic, or nuclear), and interactions with other signaling pathways.

What experimental methods are recommended for detecting CXCR4 expression in feline cancer tissues?

For reliable detection of CXCR4 in feline cancer tissues, researchers should employ multiple complementary techniques:

  • Immunohistochemistry (IHC) - The standard approach for visualizing CXCR4 protein expression in tissue sections. Researchers should note that CXCR4 may localize to cell membranes, cytoplasm, or nuclei, and the subcellular localization may have prognostic significance. Expression levels can be quantified using the extent and intensity (EI) scoring system, which is positively associated with antigen expression level .

  • Quantitative Real-Time PCR (qRT-PCR) - For measuring CXCR4 mRNA expression levels. This method complements protein detection and can reveal transcriptional regulation mechanisms .

  • Western Blotting - For semi-quantitative measurement of total CXCR4 protein levels.

  • Flow Cytometry - Particularly useful for detecting surface expression of CXCR4 on isolated cancer cells.

When reporting results, researchers should clearly document antibody specificity, localization patterns, and scoring methods to facilitate cross-study comparisons.

What is the relationship between CXCR4 signaling and angiogenesis in cancer?

CXCR4 signaling plays a significant role in promoting angiogenesis, a key process in cancer survival and metastatic spread. The CXCR4/CXCL12 axis functions as an important modulator of the angiogenesis/angiostasis balance . Microvessel density (MVD), a measure of tumor angiogenesis, has been closely associated with metastasis incidence and clinical outcomes in various studies .

In experimental models, blocking CXCR4 with antagonists such as AMD3100 significantly reduces MVD in tumor masses, as demonstrated by immunostaining against the CD34 antigen, a sensitive biomarker for blood vessels . This reduction in MVD following CXCR4 blockade suggests that CXCR4 inhibition may decrease metastasis partly through inhibition of angiogenesis .

The mechanism involves several pathways:

  • CXCR4 activation stimulates the production of angiogenic factors by tumor cells

  • CXCR4-expressing endothelial cells respond to CXCL12 gradients by proliferating and forming new vessels

  • CXCR4 signaling enhances recruitment of pro-angiogenic immune cells to the tumor microenvironment

These findings indicate that targeting CXCR4 may have dual effects on both tumor cells directly and on the tumor vasculature.

What cell models are most appropriate for studying recombinant feline CXCR4 function?

Several cell models are suitable for investigating recombinant feline CXCR4 function, each with specific advantages depending on the research question:

  • Feline Primary Cells - Isolated primary cells from feline tissues (e.g., lymphocytes, endothelial cells) provide the most physiologically relevant background but may be challenging to maintain in culture and manipulate genetically.

  • Feline Cancer Cell Lines - These allow study of CXCR4 in a species-specific cancer context and are suitable for proliferation, migration, and drug response studies.

  • Heterologous Expression Systems - Human cell lines (like HEK293 or CHO cells) transfected with feline CXCR4 constructs allow for controlled expression and detailed signaling studies.

  • Comparative Models - Using human cancer cell lines with known CXCR4 expression (such as A549, a cell strain originating from human NSCLC) as parallel models can provide valuable comparative data . These models have established protocols for proliferation assays (Cell Counting Kit-8) and migration studies (Transwell migration assays) .

When reporting research findings, clearly specify the model system used, expression levels achieved, and potential limitations in extrapolating to in vivo behavior of native feline CXCR4.

What are the recommended methods for assessing CXCR4-mediated cell migration?

For assessing CXCR4-mediated cell migration, the Transwell migration assay is the gold standard methodology. This approach has been successfully implemented in studies examining CXCR4-expressing cancer cells, including A549 NSCLC cells . The protocol involves:

  • Seeding CXCR4-expressing cells in the upper chamber of a Transwell insert

  • Adding CXCL12 (SDF-1α) to the lower chamber as a chemoattractant

  • Allowing migration for 12-24 hours (optimization required for specific cell types)

  • Fixing and staining cells (e.g., crystal violet) that have migrated through the membrane

  • Quantifying migration by counting cells or measuring dye extraction

To confirm CXCR4 specificity, researchers should include control conditions:

  • Cells treated with CXCR4 antagonists (e.g., AMD3100)

  • Cells with CXCR4 knockdown/knockout

  • No CXCL12 gradient controls

Results from experimental studies demonstrate that when CXCR4 is blocked by AMD3100, the number of cells migrating through the chamber membrane is markedly reduced compared to vehicle control . Crystal violet staining can effectively visualize cells that have migrated through the filter and adhered to the lower surface of the membrane .

What are the key considerations for designing in vivo experiments with recombinant feline CXCR4?

When designing in vivo experiments involving recombinant feline CXCR4, researchers should consider:

  • Model Selection:

    • Xenograft models in immunocompromised mice (e.g., nude mice) can be established by injecting cells expressing feline CXCR4

    • Syngeneic models in cats may provide more physiologically relevant results but present ethical and practical challenges

  • Experimental Parameters:

    • Clearly define endpoints for tumor growth measurements

    • Establish protocols for tissue collection and preservation

    • Design appropriate dosing schedules for CXCR4 antagonists (if used)

  • Analysis Techniques:

    • Tumor size measurements at regular intervals

    • Immunohistochemical staining for CXCR4 expression in tumor tissues

    • Assessment of microvessel density using endothelial markers like CD34

    • Evaluation of metastatic spread to organs with high CXCL12 expression

  • Controls and Validation:

    • Include appropriate vehicle controls

    • Validate CXCR4 expression and functionality in cells before injection

    • Consider pharmacokinetic studies for CXCR4-targeting compounds

In previous studies with human CXCR4-expressing cells, NSCLC xenograft models were established by subcutaneously injecting nude mice with human A549 cells, and tumor volumes were measured following intraperitoneal administration of AMD3100 or vehicle . Such approaches can be adapted for studies with recombinant feline CXCR4.

What molecular techniques are available for manipulating CXCR4 expression in research models?

Several molecular techniques can be employed to manipulate CXCR4 expression in research models:

  • RNA Interference:

    • Small interfering RNA (siRNA) for temporary knockdown

    • Short hairpin RNA (shRNA) for stable knockdown via lentiviral or retroviral delivery

    • Studies have shown that knockdown of CXCR4 by siRNA can affect tumor cell behavior, though effects on chemotherapy-induced apoptosis may vary

  • CRISPR-Cas9 Gene Editing:

    • For complete knockout of CXCR4

    • For introduction of specific mutations or tagged versions

    • Can be used to create stable cell lines or animal models

  • Overexpression Systems:

    • Plasmid-based transient expression

    • Viral vector-mediated stable expression

    • Inducible expression systems for temporal control

  • Pharmacological Manipulation:

    • Small molecule inhibitors like AMD3100

    • Peptide antagonists derived from CXCL12 N-terminus

    • Neutralizing antibodies against CXCR4 or CXCL12

Each approach has advantages and limitations that should be considered based on the specific research question and experimental system. When reporting results, researchers should include detailed descriptions of the molecular techniques used, including verification of knockdown/overexpression efficiency and potential off-target effects.

How can researchers distinguish between CXCR4 and CXCR7 signaling in experimental systems?

Distinguishing between CXCR4 and CXCR7 signaling is crucial as both receptors can bind CXCL12 but trigger different signaling pathways. Researchers can employ several strategies:

  • Selective Antagonists:

    • AMD3100 is relatively selective for CXCR4 over CXCR7

    • CCX771 is a selective CXCR7 antagonist

    • Using these compounds separately and in combination can help differentiate receptor-specific effects

  • Expression Analysis:

    • Monitor both receptors simultaneously in experimental systems

    • Research has shown that CXCR4 and CXCR7 may be differentially regulated in disease models; for instance, in certain kidney disease models, CXCR4 expression was induced while CXCR7 expression remained unaltered

    • This differential expression can be leveraged to identify receptor-specific effects

  • Signaling Pathway Analysis:

    • CXCR4 predominantly couples to Gαi proteins, inhibiting adenylyl cyclase

    • CXCR7 primarily signals through β-arrestin-mediated pathways without significant G-protein coupling

    • Monitoring pathway-specific readouts (cAMP levels, calcium flux, β-arrestin recruitment) can help distinguish receptor activation

  • Genetic Approaches:

    • Selective knockdown/knockout of each receptor

    • Creation of cell lines expressing only one receptor type

    • Use of biased ligands that preferentially activate one receptor over the other

When interpreting results, researchers should consider potential compensatory mechanisms and cross-talk between these receptors, as they can form heterodimers with altered signaling properties.

How should researchers interpret contradictory findings regarding CXCR4's role in cancer progression?

The contradictory findings regarding CXCR4's role in cancer progression highlight the complexity of chemokine signaling in different contexts. When encountering conflicting data, researchers should consider:

When publishing results, clearly contextualize findings within the existing literature and acknowledge limitations of the experimental approach.

What are the important considerations for translating CXCR4 research from bench to bedside?

Translating CXCR4 research from laboratory findings to clinical applications requires careful consideration of several factors:

  • Physiological Importance:

    • The CXCR4/CXCL12 axis is crucial for normal development and maintenance of tissues and organs

    • Translation must be performed with extreme caution to avoid disrupting essential physiological functions

  • Efficacy Validation:

    • Preclinical efficacy should be demonstrated in multiple models

    • The therapeutic window between anti-tumor effects and physiological disruption must be clearly established

    • Both direct effects on tumor cells and indirect effects on the microenvironment should be characterized

  • Potential Side Effects:

    • Due to CXCR4's ubiquitous expression in normal tissues and its functional importance in multiple systems, blockade may cause unexpected adverse effects

    • Targeting strategies may need to be refined for tissue-specific delivery

  • Biomarker Development:

    • Identifying which patients might benefit from CXCR4-targeted therapies

    • Developing companion diagnostics to assess CXCR4 expression patterns

    • Establishing predictive biomarkers of response

  • Combination Approaches:

    • CXCR4 inhibition may be most effective when combined with other therapies

    • Potential synergies with conventional treatments should be explored

How can researchers optimize experimental design to study the relationship between CXCR4 and oxidative stress?

Recent findings have established connections between CXCR4 and oxidative stress-mediated cellular damage, particularly in kidney diseases . To effectively study this relationship, researchers should:

  • Employ Multiple Oxidative Stress Markers:

    • Malondialdehyde assay for lipid peroxidation

    • Nitrotyrosine staining for protein oxidation

    • Measurement of 8-hydroxy-2′-deoxyguanosine in urine for DNA damage

    • Assessment of NADPH oxidase subunits (NOX2, NOX4) expression

  • Utilize Appropriate Disease Models:

    • Adriamycin nephropathy (ADR) model, characterized by increased oxidative stress, podocyte injury, and proteinuria

    • Remnant kidney model after 5/6 nephrectomy

    • Chronic angiotensin II infusion models

    • Advanced oxidation protein products (AOPPs) exposure models

  • Establish Temporal Relationships:

    • Document the temporal sequence of CXCR4 upregulation relative to oxidative stress markers

    • In ADR models, CXCR4 is upregulated predominantly in podocytes as early as 3 days after injection, accompanied by markers of oxidative stress

    • This timing information helps establish causality versus consequence

  • Investigate Signaling Pathways:

    • Examine NAPDH oxidase activation

    • Assess extracellular signal-regulated kinase (ERK) phosphorylation

    • Evaluate p65 (NF-κB pathway) activation

    • These pathways have been implicated in CXCR4 induction during oxidative stress

  • Compare with Related Receptors:

    • Include CXCR7 expression analysis as a control

    • Studies have shown that while CXCR4 expression is altered in oxidative stress conditions, CXCR7 expression may remain unchanged

By comprehensively addressing these aspects in experimental design, researchers can develop a more complete understanding of how CXCR4 mediates oxidative stress-induced cellular damage in various disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.