Recombinant Cat CD9 antigen (CD9)

Shipped with Ice Packs
In Stock

Description

Introduction to CD9 and Recombinant Feline CD9 Antigen

CD9, a member of the tetraspanin transmembrane 4 superfamily (TM4SF), is a cell-surface glycoprotein involved in critical cellular processes such as adhesion, motility, membrane fusion, and signal transduction . The recombinant feline CD9 antigen refers to the genetically engineered version of the feline CD9 protein, produced for experimental studies to elucidate its biological roles and therapeutic potential. While human and murine CD9 are well-characterized, feline CD9 (CD9f) shares structural and functional homology, enabling cross-species research .

Functional Roles in Cellular Processes

Recombinant feline CD9 has been pivotal in understanding:

  • Cell Motility: Expression of CD9f in human Raji B cells enhances migration across fibronectin and laminin substrates via β1 integrin-mediated signaling .

  • Viral Pathogenesis: CD9f facilitates canine distemper virus (CDV) entry into host cells, though direct binding remains unconfirmed .

  • Signal Transduction: CD9f interacts with GP130/STAT3 pathways (inferred from human studies) , regulating processes like cardiac hypertrophy and immune responses.

CD9f in Viral Entry and Motility

  • CDV Infection: Transfection of CD9-negative cells with CD9f renders them permissive to CDV, increasing viral production 10–100 fold .

  • Integrin-Mediated Migration: CD9f expression in Raji cells boosts motility by activating tyrosine kinases and phosphorylating 110 kDa proteins .

Table 1: Functional Comparisons of CD9 Across Species

FunctionFeline CD9Human CD9
Viral Entry EnhancementCDV susceptibility HIV infectivity modulation
Motility Regulationβ1 integrin-dependent migration Metastasis suppression in cancer
Immune InteractionLimited dataMHC-II trafficking in dendritic cells

Table 2: Recombinant CD9 Production Parameters

ParameterMammalian SystemE. coli System
Yield0.1–1.0 mg/mL (post-lyophilization) Lower due to lack of glycosylation
Endotoxin Levels<0.1 ng/µg <1.0 EU/µg
Stability≤-20°C (lyophilized); 3 months (reconstituted) Short-term storage at 2–8°C

Therapeutic Implications and Future Directions

Recombinant feline CD9 serves as a model for:

  • Antiviral Strategies: Targeting CD9-integrin interactions to block viral entry .

  • Cell Therapy: Enhancing stem cell migration in regenerative medicine (based on human CD9 roles) .

  • Cardiac Hypertrophy: GP130/STAT3 pathway modulation (extrapolated from human studies) .

Future research should prioritize feline-specific studies to dissect CD9f’s role in immune regulation and cancer metastasis.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery estimates, please consult your local distributors.
Please note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
CD9; CD9 antigen; CD antigen CD9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-226
Protein Length
Full Length of Mature Protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
CD9
Target Protein Sequence
PVKGGTKCIKYLLFGFNFIFWLAGIAVLAVGLWLRFDSQTKSIFEQDSQPSSFYTGVYIL IGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIQEVQE FYKDTYNKLKSKDEPQRDTLKAIHYALDCCGLAGGVEQFISDICPQKDILSSITVKPCPE AIKEVFHNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Uniprot No.

Target Background

Function
CD9, an integral membrane protein associated with integrins, regulates various processes, including sperm-egg fusion, platelet activation and aggregation, and cell adhesion. It is expressed on the cell surface of oocytes and plays a crucial role in sperm-egg fusion, possibly by organizing multiprotein complexes and modulating the membrane morphology required for the fusion process. In myoblasts, CD9 associates with CD81 and PTGFRN, inhibiting myotube fusion during muscle regeneration. Within macrophages, it associates with CD81, beta-1, and beta-2 integrins, preventing macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. Additionally, CD9 prevents the fusion between mononuclear cell progenitors into osteoclasts, responsible for bone resorption. It functions as a receptor for PSG17, participates in platelet activation and aggregation, regulates paranodal junction formation, and is involved in cell adhesion, cell motility, and tumor metastasis.
Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Secreted, extracellular exosome.

Q&A

What is CD9 and what is its biological significance in research?

CD9 belongs to the tetraspanin family of membrane proteins characterized by four transmembrane domains and a large extracellular loop (LEL). This protein plays critical roles in diverse cellular processes including cell adhesion, migration, fusion, and signal transduction. CD9 is widely expressed across different cell types and participates in numerous biological functions, from reproductive processes to immune responses.

The significance of CD9 in research stems from its involvement in multiple cellular mechanisms. CD9 functions as an organizer of membrane microdomains, facilitating the assembly of multiprotein complexes that regulate cellular processes . This organizational capacity makes CD9 important in contexts ranging from extracellular vesicle dynamics to viral infection mechanisms, positioning it as a significant target for both basic research and therapeutic development .

How does the molecular structure of CD9 relate to its function in biological systems?

CD9's structure consists of four transmembrane domains with intracellular N- and C-termini, a small extracellular loop (SEL), and a large extracellular loop (LEL). The LEL contains disulfide bonds critical for protein folding and function, serving as the primary interaction site with partner proteins . This structural arrangement enables CD9 to create and organize membrane microdomains often referred to as "tetraspanin-enriched microdomains" (TEMs).

The functional significance of CD9's structure is particularly evident in viral infection contexts. Research demonstrates that the LEL region mediates many protein-protein interactions, making it a prime target for therapeutic development. When studying MERS-coronavirus entry, researchers found that CD9 facilitates viral infection by bringing together the virus receptor (DPP4) and the activating protease (TMPRSS2), creating an efficient viral entry portal . This clustering function directly relates to CD9's ability to organize membrane domains through its distinctive tetraspanin structure.

What are the key differences between recombinant and native CD9 that researchers should consider?

Recombinant CD9 is produced in laboratory expression systems after introducing the CD9 gene into host cells, while native CD9 exists naturally in cellular membranes with all its endogenous post-translational modifications. These differences create several important considerations for researchers:

CharacteristicRecombinant CD9Native CD9
Structural integrityMay lack some post-translational modifications depending on expression systemContains all natural modifications and membrane context
AvailabilityCan be produced in larger quantitiesLimited to extraction from biological samples
ReproducibilityMore consistent between batchesMay vary between tissue sources
Experimental flexibilityCan include tags for purification/detection or focus on specific domains (e.g., LEL) Maintains natural interactions within membrane environment
Functional authenticityMay not perfectly recapitulate all native functionsRepresents the physiologically relevant form

When designing experiments with recombinant CD9, researchers often focus on the LEL domain rather than full-length protein, as seen in studies where "recombinant CD9 LEL produced as a soluble protein" was used for immunization to develop targeted antibodies . This approach provides a practical compromise between ease of production and retention of key functional properties.

How can researchers effectively detect CD9 expression in biological samples?

Multiple complementary techniques allow for reliable detection of CD9 in different sample types:

  • Immunoblotting techniques:

    • Western blotting accurately identifies CD9 in cell and tissue lysates or isolated EVs. This approach confirms both the presence and molecular weight of CD9, as demonstrated in studies of extracellular vesicles where CD9 serves as a classical marker .

    • Dot blotting can provide rapid screening for CD9 presence without size separation.

  • Cellular imaging approaches:

    • Immunofluorescence microscopy visualizes CD9 localization in fixed cells or tissues.

    • Flow cytometry quantifies CD9 expression at the single-cell level using fluorescently-labeled antibodies, enabling identification of CD9-positive populations across multiple cell types .

  • Molecular detection methods:

    • qPCR measures CD9 mRNA expression levels, though this doesn't confirm protein translation.

    • Digital PCR offers higher sensitivity for low-abundance detection.

  • Advanced analytical techniques:

    • Mass spectrometry provides unbiased protein identification and quantification.

    • Proximity ligation assays detect CD9 interactions with partner proteins in situ.

    • Pull-down with CD9 magnetic beads followed by flow cytometry analysis offers sensitivity for detecting CD9 in complex samples, including extracellular vesicles .

Researchers should select detection methods based on their specific experimental questions and available sample types, often combining multiple approaches for comprehensive characterization.

What are the most effective strategies for expression and purification of recombinant CD9?

Producing high-quality recombinant CD9 requires addressing several challenges inherent to membrane proteins:

  • Expression system selection:

    • For full-length CD9: Mammalian expression systems better maintain proper folding and post-translational modifications.

    • For soluble domains: Bacterial systems may sufficiently express the LEL domain, as demonstrated in research where CD9 LEL was produced for nanobody development .

  • Domain-focused approach:

    • Rather than expressing full transmembrane CD9, researchers often focus on the LEL domain, which retains many functional interactions while being more amenable to recombinant production.

    • This approach yielded 4 mg/L of purified protein in published research, representing a reasonable yield for a recombinant protein domain .

  • Purification workflow:

    • Initial capture: Affinity chromatography using tags (His, GST) for efficient initial purification.

    • Secondary purification: Size-exclusion chromatography to ensure monomeric protein and remove aggregates, as demonstrated in protocols using "two rounds of size-exclusion chromatography" to produce "a monomeric 11-kDa protein" .

    • Quality assessment: Validation through SDS-PAGE, western blotting with conformation-specific antibodies, and functional assays.

  • Folding validation:

    • Confirm proper folding through ELISA and western blot analysis with antibodies known to recognize conformational epitopes .

    • Circular dichroism can provide additional structural information.

The purification strategy should be tailored to the specific research application, with particular attention to maintaining the functional integrity of CD9's interaction domains.

What experimental approaches reveal CD9's interaction with other proteins?

Understanding CD9's protein-protein interactions requires methods that preserve its membrane context:

  • Membrane-preserving biochemical approaches:

    • Co-immunoprecipitation using mild detergents like CHAPS, which "solubilizes cell membranes while leaving tetraspanin-mediated protein interactions largely intact" .

    • Biochemical isolation of tetraspanin-enriched membrane fractions can capture intact protein complexes .

    • Crosslinking followed by mass spectrometry identifies interaction networks.

  • Imaging-based interaction analysis:

    • Confocal microscopy with co-localization analysis quantifies spatial relationships between CD9 and potential partners.

    • The formation of DPP4/TMPRSS2 foci can be visualized and quantified, with research showing "10-fold more abundant foci" when CD9 is present .

    • Proximity ligation assays provide higher sensitivity for detecting protein-protein interactions in situ.

  • Functional validation approaches:

    • Knockdown/knockout studies assess whether removal of CD9 disrupts protein complex formation.

    • Competition experiments with antibodies or soluble CD9 domains can confirm specific interactions.

    • Mutagenesis of key CD9 residues can map interaction interfaces.

  • Quantitative interaction measurements:

    • Surface plasmon resonance (SPR) provides binding kinetics and affinity measurements.

    • Isothermal titration calorimetry (ITC) offers thermodynamic parameters of binding.

Research demonstrates that these approaches can reveal functional complexes, such as CD9's role in bringing together viral receptors (DPP4) and proteases (TMPRSS2) to create efficient viral entry portals . Choosing the appropriate method depends on the specific interaction being studied and the biological context of interest.

How does CD9 contribute to viral infection mechanisms?

CD9 plays significant roles in viral infection through several mechanisms:

  • Viral entry facilitation:

    • For MERS-coronavirus: CD9 functions as an organizational hub, bringing together the virus receptor (DPP4) and the protease (TMPRSS2) needed for viral activation .

    • This creates a "multipartite complex that minimally includes the virus receptor, a virus-activating protease, and one or more tetraspanins" .

    • These complexes significantly increase cell susceptibility to virus entry, with research showing that CD9 increases the number of DPP4/TMPRSS2 foci by 10-fold, correlating with greater virus entry .

  • Virus-specific selectivity:

    • CD9 shows selectivity in its viral facilitation role, promoting entry for some coronaviruses (MERS-CoV and 229E-CoV) but not others (SARS-CoV or MHV-CoV) .

    • This selectivity relates to CD9's specific interactions with particular viral receptors (DPP4 for MERS-CoV, APN for 229E-CoV) .

  • Role in HIV-1 replication:

    • CD9 is involved in the HIV-1 life cycle, with nanobodies targeting CD9 shown to inhibit virus replication and syncytia formation .

    • CD9-directed nanobodies "effectively inhibited cell-cell spread of infection and HIV-1 replication in T cells and macrophages" .

These findings have significant implications for antiviral research, suggesting that CD9-targeting approaches could disrupt viral entry mechanisms. The host-directed nature of such interventions might offer advantages over virus-targeted therapies, potentially providing activity against multiple viruses that depend on similar host machinery and reducing vulnerability to viral resistance mechanisms .

What is CD9's role in extracellular vesicle biology?

CD9 has traditionally been considered a key marker and functional component of extracellular vesicles (EVs), though recent research challenges some assumptions:

  • EV marker functionality:

    • CD9 serves as a classical marker for extracellular vesicles, used to identify and characterize EV populations in research and clinical applications .

    • EVs isolated by sequential ultracentrifugation show enrichment in CD9 (and CD63), confirming its utility as an identification marker .

  • Functional requirements in EV processes:

    • Contrary to expectations, research using CD9 knockdown/knockout approaches found that "CD63 and CD9 tetraspanins are knocked-down and shown to not be required for extracellular vesicle uptake and cargo delivery" .

    • Studies measuring luminescence from EV cargo found "no differences were observed between the control and cells depleted of CD63 or CD9" in terms of EV uptake or cargo delivery .

    • Quantification of GFP-positive foci within acceptor cells "did not reveal any differences between control cells and CD63/CD9 KO cells," suggesting that CD9 is not essential for EV internalization .

  • EV production dynamics:

    • Nanoparticle tracking analysis showed "no significant changes in EV release upon CD9 or CD63 knockdown" .

    • This indicates that while CD9 is present in EVs, it may not be critical for their biogenesis and release.

These findings highlight the complex and potentially context-dependent roles of CD9 in EV biology. While CD9 remains valuable as an EV marker, its functional importance in EV processes appears more nuanced than previously assumed, underscoring the importance of experimental validation when studying tetraspanin functions in EV biology.

How can CD9-targeting therapeutics be developed?

Development of CD9-targeting therapeutics represents an emerging approach with several promising avenues:

  • Nanobody development strategies:

    • Llama immunization with recombinant CD9 LEL offers an effective approach for generating single-domain antibodies against CD9 .

    • Phage display library construction and screening enables isolation of high-affinity binders, as demonstrated in research that identified "eight clonally distinct nanobodies targeting CD9" .

    • Characterization through techniques like ELISA, SPR, and cell-binding assays helps identify the most promising candidates for therapeutic development .

  • Targeting specificity considerations:

    • Different nanobodies exhibit varying affinities and cell-binding profiles:

      • Some (like T2C002) demonstrate "strong binding across all cell lines tested" .

      • Others show more selective binding patterns or "differential sensitivities against surface-expressed CD9" .

    • This range of binding properties enables selection of candidates with desired specificity profiles.

  • Therapeutic applications:

    • Antiviral therapy: CD9-directed nanobodies inhibited HIV-1 replication and prevented syncytia formation, potentially "augmenting existing antiretroviral treatments for HIV-1" .

    • Potential applications for other viruses where CD9 plays a facilitative role, such as MERS-CoV .

    • Possible utility in blocking cellular processes dependent on CD9-organized membrane domains.

  • Efficacy validation in disease models:

    Therapeutic ApproachDisease ModelKey Findings
    CD9-directed nanobodiesHIV-1 infection in T cellsSignificant inhibition of virus replication
    CD9-directed nanobodiesHIV-1 infection in macrophagesPrevented virus replication
    CD9-directed nanobodiesSyncytia formationEffective inhibition
  • Development considerations:

    • Target validation in relevant disease models

    • Lead optimization for affinity, stability, and pharmacokinetics

    • Safety assessment with attention to CD9's physiological roles

    • Delivery strategies appropriate to the therapeutic context

This research opens "new avenues for host-targeted therapeutic strategies," providing proof-of-concept for CD9-directed approaches that could be applicable across multiple disease contexts .

How do cellular contexts influence CD9 function in different research models?

CD9 function varies significantly across cellular contexts, affecting experimental design and interpretation:

  • Cell type-specific effects:

    • CD9 binding to cell surfaces shows remarkable variability across cell lines, with studies showing that nanobodies like "T2C007, despite its low affinity for CD9 LEL protein (affinity >1,000 nM), demonstrated the most pronounced binding across all tested cell lines" .

    • Conversely, other nanobodies with high affinity for purified CD9 showed little to no binding to cells, highlighting the importance of cellular context in CD9 accessibility and function .

  • Expression level effects:

    • Native versus overexpressed CD9 can display different behaviors, with some nanobodies exhibiting "differential sensitivities against endogenous and overexpressed CD9 on the cell surface" .

    • This suggests that CD9 organization, accessibility, or conformation may differ depending on expression levels.

  • Functional redundancy with other tetraspanins:

    • Studies examining both CD9 and CD63 knockdown suggest potential functional overlap or compensation mechanisms between tetraspanins .

    • This redundancy may explain why depletion of CD9 alone sometimes produces minimal phenotypic effects.

  • Membrane microdomain organization:

    • CD9's role in organizing membrane microdomains appears context-dependent, with greater impact when interaction partners are sparse on cell surfaces.

    • Research shows that "CD9 connects DPP4 and TMPRSS2 entry factors, and is necessary for their proximity when they are sparse on cell surfaces" .

    • With overexpression of interaction partners, the organizational role of CD9 remains beneficial but becomes less essential .

Understanding these contextual influences is critical when designing CD9 research across different experimental systems, emphasizing the importance of using multiple cell types and expression conditions to validate findings.

What are current controversies in understanding CD9's molecular mechanisms?

Several significant controversies and knowledge gaps exist in CD9 research:

  • Extracellular vesicle functionality:

    • Traditional view: CD9 as a functional component essential for EV processes.

    • Challenging evidence: Research demonstrates that "CD63 and CD9 tetraspanins are knocked-down and shown to not be required for extracellular vesicle uptake and cargo delivery" .

    • This contradicts expectations that CD9, as a common EV marker, would be functionally important for EV processes.

    • Unresolved question: What is CD9's precise role in EV biogenesis, cargo loading, and uptake mechanisms?

  • Virus-specific roles:

    • Established finding: CD9 facilitates entry of some coronaviruses (MERS-CoV, 229E-CoV) but not others (SARS-CoV, MHV-CoV) .

    • Controversy: The molecular basis for this virus specificity remains incompletely explained.

    • Research gap: What structural features of CD9 determine its virus-specific functions?

  • Multiprotein complex formation dynamics:

    • Current understanding: CD9 organizes multiprotein complexes by bringing together interaction partners like DPP4 and TMPRSS2 .

    • Unresolved questions:

      • Are these complexes pre-formed or assembled in response to specific stimuli?

      • What regulates the composition and stability of CD9-organized complexes?

      • How do other membrane components (lipids, cytoskeleton) influence these processes?

  • Tetraspanin redundancy versus specificity:

    • Evidence for redundancy: Some studies suggest overlapping functions between CD9 and other tetraspanins like CD63 .

    • Evidence for specificity: Other research demonstrates unique roles for CD9 in processes like viral entry .

    • Unresolved tension: Determining when CD9 functions are unique versus redundant with other tetraspanins.

These controversies highlight the complex and context-dependent nature of CD9 biology, emphasizing the need for careful experimental design and multiple complementary approaches when investigating CD9 functions.

What emerging technologies are advancing CD9 research?

Several technological innovations are transforming how researchers study CD9 biology:

  • Advanced antibody technologies:

    • Nanobody development: Llama-derived nanobodies offer advantages of small size, stability, and unique epitope recognition compared to conventional antibodies .

    • These single-domain antibodies provide "new avenues for host-targeted therapeutic strategies" while also serving as powerful research tools .

    • The generation of "eight clonally distinct nanobodies targeting CD9, each exhibiting a range of affinities and differential binding to cell surface-expressed CD9" demonstrates the diversity of targeting options this technology enables .

  • Genome editing approaches:

    • CRISPR-Cas9 technology: The creation of CD9 knockout cell lines provides cleaner genetic models compared to earlier knockdown approaches .

    • This technology enables precise assessment of CD9's functional importance across different cellular contexts.

  • Advanced imaging techniques:

    • Quantitative imaging approaches allow precise measurement of protein co-localization, as demonstrated in research quantifying DPP4 and TMPRSS2 foci in relation to CD9 expression .

    • These techniques revealed that "CD9 sensitizes cells to MERS-CoV entry by bringing DPP4 and TMPRSS2 into proximity," with quantifiable differences in foci formation .

  • Reporter systems for tracking CD9-dependent processes:

    • Luminescent cargo tracking: NLuc-HSP70 fusion proteins enable quantitative assessment of processes like EV uptake and cargo delivery .

    • Fluorescent protein fusions allow visualization of CD9-dependent trafficking events in living cells .

  • Specialized viral infection models:

    • Pseudovirus systems provide safer and more quantifiable approaches for studying CD9's role in viral entry, as demonstrated with MERS-CoV pseudoviruses .

    • These models enable precise measurement of how CD9 "allowed MERS-CoV pseudoviruses to enter cells rapidly and efficiently" .

  • Functional screening approaches:

    • Phage display technology facilitates the identification of CD9-targeting molecules with specific binding properties .

    • High-throughput screening enables identification of compounds that modulate CD9 function or its protein-protein interactions.

These technological advances collectively enhance researchers' ability to investigate CD9 biology at multiple scales, from molecular interactions to cellular functions, driving rapid progress in understanding this multifunctional tetraspanin.

What are the critical quality control measures for recombinant CD9 in research applications?

Ensuring high-quality recombinant CD9 requires rigorous quality control measures:

  • Purity and homogeneity assessment:

    • SDS-PAGE analysis confirms protein size and purity.

    • Size-exclusion chromatography verifies homogeneity and absence of aggregates, as demonstrated in protocols using "two rounds of size-exclusion chromatography" to produce "a monomeric 11-kDa protein" .

    • Mass spectrometry confirms precise molecular weight and potential modifications.

  • Structural integrity validation:

    • Conformation-specific antibody recognition through ELISA and western blotting confirms proper protein folding .

    • Circular dichroism spectroscopy assesses secondary structure elements.

    • Thermal shift assays evaluate protein stability under different conditions.

  • Functional validation:

    • Binding activity assessment with known interaction partners.

    • Comparison with native CD9 in functional assays.

    • Bioactivity assays relevant to the research context (e.g., effects on viral entry if studying infection mechanisms).

  • Batch consistency monitoring:

    Quality ParameterAcceptance CriteriaMethods
    Purity>95%SDS-PAGE, HPLC
    SizeConsistent with expected molecular weightMass spectrometry
    FoldingRecognition by conformation-specific antibodiesELISA, western blot
    ActivityComparable to reference standardBinding assays, functional tests
    Endotoxin levels<0.1 EU/μg for cell-based applicationsLAL assay
  • Storage stability assessment:

    • Accelerated stability studies to predict shelf-life.

    • Activity testing after storage under different conditions.

    • Freeze-thaw stability evaluation.

  • Documentation and traceability:

    • Detailed records of production processes.

    • Certificate of analysis for each batch.

    • Reference standards for comparative analysis.

These quality control measures ensure that experimental findings with recombinant CD9 are reliable and reproducible across different research applications.

What experimental controls are essential when investigating CD9 functions?

Proper experimental controls are critical for robust CD9 research:

  • Genetic controls:

    • CD9 knockout cells provide essential negative controls, as used in research where "efficiency of the Cas9-mediated KO was confirmed by immunoblot" .

    • Rescue experiments with re-expression of CD9 confirm phenotype specificity.

    • Knockdown approaches with validated siRNAs offer an alternative when knockout is not feasible, with studies confirming "93% knockdown" through qPCR validation .

  • Protein-level controls:

    • Isotype-matched irrelevant antibodies control for non-specific effects in antibody-based studies.

    • Other tetraspanin family members (e.g., CD63, CD81) serve as specificity controls to distinguish CD9-specific from general tetraspanin effects .

    • Denatured CD9 controls for structure-dependent functions.

  • Cell type controls:

    • CD9-negative cell lines (e.g., Raji cells) provide important negative controls, with research confirming "no binding was observed to CD9-deficient Raji cells" .

    • Multiple CD9-positive cell lines help identify cell type-specific versus general CD9 functions, as studies showed variable nanobody binding "across all cell lines tested" .

  • Functional validation controls:

    • Dose-response experiments establish specificity versus non-specific effects.

    • Time-course studies determine optimal experimental timepoints.

    • Positive controls with known CD9-dependent processes validate experimental systems.

  • Technical controls:

    • Multiple independent experimental replicates ensure reproducibility.

    • Blinded analysis prevents unconscious bias in subjective assessments.

    • Multiple methodological approaches confirm key findings.

How should researchers troubleshoot common problems in CD9 experimental systems?

Researchers working with CD9 commonly encounter several challenges that require systematic troubleshooting approaches:

  • Low recombinant protein expression:

    • Problem: Poor yields of recombinant CD9, particularly for full-length protein.

    • Troubleshooting:

      • Express soluble domains (like LEL) instead of full transmembrane protein .

      • Optimize codon usage for expression system.

      • Test different expression vectors, promoters, and host strains.

      • Adjust induction conditions (temperature, duration, inducer concentration).

      • Consider fusion partners to enhance solubility and expression.

  • Protein aggregation issues:

    • Problem: Recombinant CD9 forms aggregates during expression or purification.

    • Troubleshooting:

      • Implement multi-step purification including "two rounds of size-exclusion chromatography" as demonstrated in successful protocols .

      • Optimize buffer conditions (detergents, salt concentration, pH).

      • Include stabilizing additives during purification and storage.

      • Consider refolding approaches if expression yields inclusion bodies.

  • Loss of functional activity:

    • Problem: Recombinant CD9 lacks expected binding or functional properties.

    • Troubleshooting:

      • Validate proper folding through antibody recognition assays .

      • Confirm disulfide bond formation in the LEL region.

      • Test different buffer conditions to maintain native-like conformation.

      • Compare different expression systems that may better preserve post-translational modifications.

  • Inconsistent cell binding results:

    • Problem: Variable binding of CD9-targeting reagents to different cell lines.

    • Troubleshooting:

      • Verify CD9 expression levels in target cells by western blot or flow cytometry.

      • Consider that "nanobodies have variable recognition of CD9 on cells" with some showing "differential sensitivities against endogenous and overexpressed CD9" .

      • Assess binding under different conditions (temperature, incubation time, buffer composition).

      • Evaluate potential masking effects from CD9 interactions with other membrane components.

  • Contradictory functional results:

    • Problem: Inconsistent or contradictory outcomes in CD9 functional studies.

    • Troubleshooting:

      • Consider cell type-specific effects and use multiple cell lines.

      • Assess potential redundancy with other tetraspanins that might compensate for CD9 function .

      • Evaluate expression levels of key CD9 interaction partners that might affect functional outcomes.

      • Use complementary methodological approaches to confirm findings.

These troubleshooting strategies help researchers address common challenges in CD9 research, improving experimental reliability and facilitating meaningful discoveries about this important tetraspanin protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.