Recombinant Cat Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
Full length protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
Target Protein Sequence
MAYPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTQELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMATRPGLYYGQCSEICGSNHSFMPIVLELVPLTYFEKWSASML
Uniprot No.

Target Background

Function
Recombinant Cat Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, comprising heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Gene References Into Functions
  1. JNK1 phosphorylation is crucial for activating the MEK/ERK1/2 pathway and subsequent COX-2 expression for prostaglandin E2 release. p38 independently contributes to the IL-1β effect in synovial fibroblasts. PMID: 28054591
  2. This study examines the distribution and intensity of cyclooxygenase (COX)-2 expression in feline eyes with and without uveitis. PMID: 29287164
  3. Immunohistochemical analysis of cyclooxygenase-1 (COX-1) and cyclooxygenase-2 (COX-2) expression in feline urinary bladder transitional cell carcinomas. PMID: 22408147
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its role in cellular metabolism?

MT-CO2 (mitochondrially encoded cytochrome c oxidase II) is one of the core subunits of cytochrome c oxidase (CcO), the terminal enzyme of the mitochondrial respiratory chain. It contributes to cytochrome-c oxidase activity and is involved in mitochondrial electron transport from cytochrome c to oxygen . The protein contains a dual core CuA active site that plays a significant role in the physiological process of cellular respiration . MT-CO2 is encoded by the mitochondrial genome and is located in the mitochondrial inner membrane as part of respiratory chain complex IV .

How is recombinant cat MT-CO2 typically expressed and purified?

Recombinant cat MT-CO2 is commonly expressed in E. coli expression systems, though the specific host can vary depending on research needs . The protein is typically expressed with a His-tag at the N-terminus to facilitate purification . After expression, the protein is purified using affinity chromatography, most commonly with Ni-NTA agarose columns for His-tagged proteins . The purified protein is often supplied in a stabilizing buffer containing Tris/PBS with 6% trehalose at pH 8.0 and is typically available as a lyophilized powder or in solution with 50% glycerol for extended storage .

What buffer conditions are optimal for working with recombinant MT-CO2?

For reconstitution of lyophilized recombinant MT-CO2, deionized sterile water is recommended to achieve a concentration of 0.1-1.0 mg/mL . For storage, the addition of 5-50% glycerol (with 50% being most common) is recommended before aliquoting for long-term storage at -20°C or -80°C . For functional assays, a buffer system of 30 mM potassium phosphate (KPi) at pH 7.0 with 0.05% (w/v) DDM and 1 mg/ml phosphatidylcholine has been used successfully for enzymatic activity measurements .

How can I measure the enzymatic activity of recombinant MT-CO2, and what factors might affect these measurements?

Enzymatic activity of recombinant MT-CO2 can be assessed using two primary approaches:

  • Oxidase Activity Measurement: This measures the protein's ability to catalyze electron transport from cytochrome c to oxygen. UV-spectrophotometric analysis can monitor the oxidation of reduced cytochrome c substrate over time . The decrease in absorbance at 550 nm corresponds to the oxidation of reduced cytochrome c.

  • Catalase Activity Assessment: Some studies have shown that cytochrome c oxidase also exhibits catalase activity (H₂O₂ decomposition) . This can be measured using an oxygen electrode to detect oxygen production when hydrogen peroxide is added to the purified enzyme. The linear part of the initial slope after enzyme addition (first 20-30 seconds) should be used for data analysis .

Factors affecting activity measurements include:

  • Buffer composition and pH

  • Temperature (activity decreases with prolonged exposure to temperatures above optimal)

  • Proper incorporation of metal centers (particularly copper)

  • Presence of detergents and lipids for membrane protein stabilization

  • Expression system used (E. coli vs other hosts)

Research has shown that recombinant wild-type cytochrome c oxidase may exhibit significantly different catalase activity compared to the naturally isolated enzyme, with up to 20-fold increased catalase activity in some recombinant versions .

What methodological approaches can be used to investigate the structural differences between recombinant and native MT-CO2?

Several approaches can be employed to investigate structural differences:

  • Differential Scanning Calorimetry (DSC): This technique measures the differences in heat capacity between recombinant and native proteins as a function of temperature, providing insights into thermal stability and folding properties .

  • Spectroscopic Analysis: UV/visible spectroscopy can detect subtle differences in absorbance spectra, such as broadening towards the blue in recombinant proteins compared to native ones, which might indicate structural variations .

  • Metal Content Analysis: Since MT-CO2 contains copper centers critical for function, techniques like inductively coupled plasma mass spectrometry (ICP-MS) can quantify metal incorporation differences between recombinant and native proteins.

  • Cross-linking Studies: These can identify differences in protein-protein interactions within the complex.

  • Laser-Capture Microdissection with Quantitative Pyrosequencing: This specialized technique has been used to investigate MT-CO2 variants in individual muscle fibers . It allows for the accurate determination of heteroplasmy levels of mtDNA variants down to approximately 3% .

Research has shown that recombinant MT-CO2 may show slight broadening towards the blue in absorbance spectra compared to native MT-CO2, indicating subtle structural differences that might affect function .

How do mutations in the MT-CO2 gene affect protein function, and what experimental systems can be used to study these effects?

Mutations in MT-CO2 can lead to various pathological conditions including cerebellar ataxia, neuropathy, myopathy with/without recurrent myoglobinuria, and MELAS syndrome . These mutations often affect the protein's ability to participate in electron transport, resulting in mitochondrial dysfunction.

Experimental systems to study mutation effects include:

  • Single Fiber Segregation Studies: This approach involves isolating individual muscle fibers and analyzing MT-CO2 variants to determine how mutations segregate and affect function at the cellular level. COX-deficient and COX-positive fibers can be compared .

  • Heteroplasmy Analysis: Quantitative pyrosequencing assays on a PyroMark Q24 platform can accurately determine heteroplasmy levels of mtDNA variants in different tissues (muscle, urinary sediments, blood, buccal epithelia) .

  • Recombinant Expression Systems: Wild-type and mutant MT-CO2 variants can be expressed in E. coli to study how specific mutations affect protein assembly, stability, and function .

  • Molecular Docking Methods: These computational approaches can predict how mutations might affect binding of substrates or inhibitors to MT-CO2. For example, studies have shown that allyl isothiocyanate (AITC) can form a hydrogen bond with specific amino acid residues in MT-CO2 .

Research has demonstrated that novel variants like m.7887G>A p.(Gly101Asp) in MT-CO2 can cause mitochondrial biochemical defects leading to clinical presentations such as cerebellar ataxia and neuropathy .

What are the considerations for designing experiments comparing MT-CO2 from different species, and how might interspecies variations impact research findings?

When comparing MT-CO2 across species, several considerations are essential:

  • Sequence Homology Analysis: Multiple sequence alignment and phylogenetic analysis are crucial first steps. For example, studies have shown that insect MT-CO2 has high sequence identity with MT-CO2 from other insect species , while vertebrate MT-CO2 proteins also share significant homology.

  • Expression System Selection: The same expression system should be used for all species variants to minimize host-dependent variations. E. coli is commonly used, but the choice should be consistent .

  • Functional Domain Conservation: Focus on conserved functional domains like the CuA center (copper-binding site) when designing comparative studies.

  • Molecular Weight and pI Variations: Different species have MT-CO2 proteins with varying molecular weights and isoelectric points. For example:

    • Cat MT-CO2: ~26.1 kDa

    • Rat MT-CO2: ~22 kDa

    • Hoary fox MT-CO2: Contains 227 amino acids, similar to cat

  • Assay Standardization: When comparing enzymatic activities, identical assay conditions must be used, with attention to species-specific optimal conditions.

Interspecies variations can significantly impact research findings. While the core function of MT-CO2 is conserved across species, differences in amino acid sequence can affect:

  • Protein stability

  • Interaction with other subunits

  • Enzymatic activity and kinetics

  • Response to inhibitors and environmental stressors

For example, when comparing rat cytochrome c oxidase with recombinant versions, significant differences in catalase activity (20-fold higher in recombinant versions) have been observed, highlighting the importance of considering species-specific and expression system-specific variations .

What strategies can overcome the challenges of expressing functional mitochondrial proteins like MT-CO2 in bacterial systems?

Expressing functional mitochondrial proteins in bacterial systems presents several challenges:

  • Codon Optimization: Mitochondrial genomes use a slightly different genetic code than nuclear genes. Strategies include:

    • Codon optimization for E. coli expression

    • Use of expression vectors with rare codon supplementation

    • Employing specialized E. coli strains like Transetta (DE3) that contain additional tRNAs for rare codons

  • Metal Center Incorporation: For proper insertion of the copper centers:

    • Co-expression with metal chaperones

    • Supplementation of growth media with copper

    • Post-purification reconstitution with copper

  • Membrane Protein Solubility: As MT-CO2 is a membrane protein:

    • Use of fusion tags that enhance solubility (His-tags are common)

    • Addition of detergents like DDM (0.05% w/v) during purification

    • Incorporation of phospholipids (1 mg/ml phosphatidylcholine) in storage buffers

  • Proper Folding: To ensure correct protein folding:

    • Lower induction temperatures (16-25°C)

    • Use of folding-promoting additives like trehalose (6%) in storage buffers

    • Co-expression with chaperone proteins

Implementation of these strategies has successfully produced functional recombinant MT-CO2 proteins capable of catalyzing the oxidation of cytochrome c substrate, as verified by UV-spectrophotometer analysis .

How can researchers differentiate between technical artifacts and genuine biological effects when studying recombinant MT-CO2?

Differentiating between technical artifacts and genuine biological effects requires multiple control experiments and validation approaches:

  • Multiple Expression Systems Comparison:

    • Express the protein in different systems (E. coli, yeast, baculovirus, mammalian cells)

    • Compare functional properties across expression systems

    • Identify consistent effects across different expression backgrounds

  • Native vs. Recombinant Protein Comparison:

    • Direct comparison with naturally isolated MT-CO2

    • Analysis of spectral properties (UV/vis spectra)

    • Assessment of enzymatic activities under identical conditions

  • Tag Effects Evaluation:

    • Compare tagged vs. untagged proteins

    • Test multiple tag positions (N-terminal vs. C-terminal)

    • Perform tag removal experiments using proteases

  • Multiple Analytical Techniques:

    • Combine biochemical, biophysical, and structural approaches

    • Cross-validate findings using independent methodologies

    • Use quantitative assays with appropriate statistical analysis

  • Heteroplasmy Level Considerations:

    • When studying MT-CO2 variants, use quantitative assays that can reliably detect heteroplasmy to levels >3%

    • Compare results across multiple tissues (muscle, blood, urinary sediments, buccal epithelia)

Research has demonstrated that recombinant wild-type cytochrome c oxidase can show a 20-fold increased catalase activity compared to the naturally isolated enzyme, highlighting the importance of distinguishing technical artifacts from biological properties .

What are the most effective experimental designs for validating the authenticity and functionality of recombinant MT-CO2?

Effective experimental designs for validating recombinant MT-CO2 should include:

  • Comprehensive Protein Characterization:

    • SDS-PAGE for purity assessment (>90% purity standard)

    • Western blotting with specific antibodies

    • Mass spectrometry for molecular weight verification

    • N-terminal sequencing to confirm protein identity

  • Functional Validation Suite:

    • Cytochrome c oxidation assays using UV-spectrophotometry

    • Oxygen consumption measurements

    • Hydrogen peroxide decomposition (catalase activity) assays

    • Comparison with native enzyme activity under identical conditions

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy for secondary structure analysis

    • Thermal stability measurements through differential scanning calorimetry

    • Metal content analysis to verify copper incorporation

  • Interaction Studies:

    • Complex formation with other cytochrome c oxidase subunits

    • Lipid interactions for membrane proteins

    • Inhibitor binding studies

  • Controls and References:

    • Positive control using well-characterized MT-CO2 from reference sources

    • Negative controls using denatured protein or known inactive mutants

    • Activity comparisons with published reference values

Research has shown that recombinant MT-CO2 can successfully catalyze the oxidation of substrate cytochrome c, with activity being influenced by compounds like allyl isothiocyanate (AITC), which can form specific hydrogen bonds with amino acid residues (e.g., Leu-31) .

How can recombinant MT-CO2 be utilized to study mitochondrial disorders, and what are the limitations of such models?

Recombinant MT-CO2 serves as a valuable tool for studying mitochondrial disorders through several approaches:

  • Mutation Analysis:

    • Engineering disease-associated mutations (like m.7887G>A p.(Gly101Asp)) into recombinant MT-CO2

    • Comparing biochemical properties of wild-type and mutant proteins

    • Evaluating how specific mutations affect enzyme activity and stability

  • Structure-Function Relationships:

    • Investigating how mutations in MT-CO2 affect its interaction with other subunits

    • Studying the impact of mutations on copper center formation and electron transfer

    • Examining how structural alterations translate to functional deficits

  • Drug Screening Platforms:

    • Testing compounds that might rescue mutant MT-CO2 function

    • Screening for molecules that enhance mitochondrial function

    • Evaluating potential therapies for mitochondrial disorders

Limitations include:

  • Isolated Protein vs. Complex System:

    • Recombinant MT-CO2 lacks the context of the complete cytochrome c oxidase complex

    • Cellular environment factors are absent in purified protein studies

    • Heteroplasmy effects cannot be fully replicated in recombinant systems

  • Expression System Artifacts:

    • Bacterial expression may lead to different post-translational modifications

    • Recombinant proteins may show altered activities compared to native forms (e.g., 20-fold higher catalase activity)

    • Potential incorrect folding or metal incorporation

  • Disease Complexity:

    • Many mitochondrial disorders involve multiple genes and proteins

    • Tissue-specific effects are difficult to model with recombinant proteins

    • Heteroplasmy levels vary across tissues and affect disease manifestation

MT-CO2 mutations have been linked to various clinical phenotypes including myopathy with/without recurrent myoglobinuria, neurodevelopmental delay, gait disorders, cardiac involvement, retinitis pigmentosa, lactic acidosis, MELAS syndrome, and progressive cerebellar ataxia .

What emerging technologies might enhance our understanding of MT-CO2 structure and function in the next decade?

Several emerging technologies show promise for advancing MT-CO2 research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • High-resolution structural determination of membrane proteins in native-like environments

    • Visualization of MT-CO2 within the complete cytochrome c oxidase complex

    • Structural insights into mutation effects without crystallization requirements

  • Single-Molecule Techniques:

    • Real-time observation of electron transfer events

    • Direct measurement of conformational changes during catalysis

    • Characterization of heterogeneity in molecular behavior

  • Advanced Computational Methods:

    • Molecular dynamics simulations of MT-CO2 in membrane environments

    • Quantum mechanical calculations of electron transfer processes

    • AI-based prediction of mutation effects on protein function

  • CRISPR-Based Mitochondrial Genome Editing:

    • Precise introduction of MT-CO2 mutations in cellular models

    • Creation of isogenic cell lines differing only in MT-CO2 sequence

    • Control of heteroplasmy levels to model disease progression

  • Single-Cell and Spatial Transcriptomics/Proteomics:

    • Analysis of MT-CO2 expression and function at single-cell resolution

    • Tissue-specific studies of MT-CO2 variants

    • Correlation of heteroplasmy with functional outcomes at cellular level

  • Advanced Laser-Capture Microdissection with Next-Generation Sequencing:

    • Building on current techniques that can accurately determine heteroplasmy levels

    • Integration with proteomics and metabolomics

    • Higher throughput analysis of multiple tissue samples and cellular subtypes

These technologies will likely provide unprecedented insights into how MT-CO2 structure relates to function and how mutations lead to disease phenotypes, potentially opening new avenues for therapeutic interventions.

How might our understanding of MT-CO2 contribute to the development of novel therapeutic approaches for mitochondrial diseases?

Insights from MT-CO2 research could contribute to therapeutic development through several pathways:

  • Precision Medicine Approaches:

    • Mutation-specific therapies based on structural understanding

    • Personalized treatment strategies based on heteroplasmy levels

    • Targeted interventions for specific MT-CO2 variants

  • Small Molecule Development:

    • Design of compounds that stabilize mutant MT-CO2 proteins

    • Development of molecules that enhance residual enzyme activity

    • Creation of small molecules that improve copper center formation

  • Gene Therapy and Editing:

    • Mitochondrial targeted nucleases to reduce heteroplasmy of mutant MT-CO2

    • Introduction of wild-type MT-CO2 genes into mitochondria

    • CRISPR-based approaches for mitochondrial genome editing

  • Protein Replacement Strategies:

    • Delivery of functional recombinant MT-CO2 to affected tissues

    • Development of mitochondria-targeted protein delivery systems

    • Allotopic expression of MT-CO2 from the nuclear genome

  • Metabolic Bypass Approaches:

    • Alternative electron transport pathways to circumvent MT-CO2 defects

    • Metabolic modifiers that reduce dependency on complex IV

    • Enhancers of mitochondrial biogenesis to increase functional mitochondria

Understanding the structural and functional properties of MT-CO2 is crucial, as mutations in this gene have been linked to several clinical phenotypes with different disease onset, including myopathy, neurodevelopmental delay, gait disorders, cardiac involvement, retinitis pigmentosa, lactic acidosis, MELAS syndrome, and progressive cerebellar ataxia .

What are the implications of species differences in MT-CO2 for translational research and evolutionary studies?

Species differences in MT-CO2 have significant implications for both translational research and evolutionary studies:

Translational Research Implications:

  • Model Selection Concerns:

    • Different species (rat , cat , fox , etc.) have MT-CO2 with varying amino acid sequences

    • These differences may affect drug interactions and disease mechanisms

    • Careful consideration is needed when selecting animal models for mitochondrial disease studies

  • Cross-Species Extrapolation Challenges:

    • Results from one species may not directly translate to humans

    • Functional differences in MT-CO2 can lead to species-specific responses to therapeutic interventions

    • Compensation mechanisms may differ across species

  • Personalized Medicine Considerations:

    • Understanding species differences informs human genetic variation implications

    • Polymorphisms in human MT-CO2 may have functional consequences similar to species differences

    • Therapeutic approaches may need to account for genetic diversity

Evolutionary Study Implications:

  • Molecular Clock Applications:

    • MT-CO2 sequence differences serve as markers for evolutionary divergence

    • Rate of MT-CO2 evolution can be used to estimate species divergence times

    • Phylogenetic analysis of MT-CO2 helps establish evolutionary relationships

  • Adaptive Evolution Insights:

    • Species-specific adaptations in MT-CO2 may reflect metabolic requirements

    • Environmental pressures (temperature, oxygen availability) shape MT-CO2 evolution

    • Positive selection signatures may identify functionally important regions

  • Structural-Functional Conservation Patterns:

    • Highly conserved regions typically represent essential functional domains

    • The CuA center (copper-binding site) shows high conservation across species

    • Variable regions may indicate species-specific adaptations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.