Recombinant Cat Kit ligand (KITLG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
KITLG; SCF; Kit ligand; Mast cell growth factor; MGF; Stem cell factor; c-Kit ligand
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-274
Protein Length
Full Length of Mature Protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
Target Protein Sequence
KGLCRNRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECVEGHSSENVKKSSKSPEPRLFTPEEFFRIFNRSIDAFKDLEMVASKTSECVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKATNPIEDSSIQWAVMALPACFSLVIGFAFGAFYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
Uniprot No.

Target Background

Function
This protein stimulates mast cell proliferation. It can enhance the proliferation of both myeloid and lymphoid hematopoietic progenitors in bone marrow culture. Additionally, it mediates cell-cell adhesion and acts synergistically with other cytokines, likely interleukins.
Gene References Into Functions
  1. This study investigated SCF expression in 23 feline mast cell tumor (MCT) samples. SCF expression was detected in 10 cutaneous MCTs and a case of splenic mastocytosis. PMID: 30213375
  2. The results demonstrate that SCF promotes follicle development by upregulating c-kit mRNA expression and AKT phosphorylation. EGF suppresses the stimulatory effect of SCF, leading to a downregulation of FSHr expression. PMID: 27279472
Database Links
Protein Families
SCF family
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Secreted.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Single-pass type I membrane protein. Cell projection, lamellipodium. Cell projection, filopodium.; [Soluble KIT ligand]: Secreted.

Q&A

What is KITLG and what is its primary function in feline biology?

KITLG, also known as stem cell factor (SCF) or mast cell growth factor, functions as the ligand for the KIT receptor tyrosine kinase. When KITLG binds to KIT, it triggers receptor dimerization and initiates diverse cellular responses. In cats, as in other mammals, KITLG plays a crucial role in the development and maintenance of the melanocyte lineage in adult skin . The protein is produced locally in skin by epidermal keratinocytes and endothelial cells, where it induces the migration, development, and survival of melanocytes . While most research has focused on human KITLG, the feline ortholog shares significant structural and functional homology, making it an important research target for comparative studies.

How does recombinant cat KITLG differ from endogenous KITLG in structure and function?

Recombinant cat KITLG is engineered to replicate the structure and function of natural feline KITLG, though some differences may exist depending on the expression system used. The key distinction is that recombinant KITLG is typically produced as the soluble form (sKITLG) without the transmembrane domain, similar to how recombinant human KITLG is produced. Research on human KITLG has shown that the soluble form can induce hyperpigmentation when injected into skin tissue, demonstrating its biological activity . For feline studies, researchers should validate that recombinant cat KITLG retains appropriate folding and post-translational modifications to ensure functional equivalence to the endogenous protein.

What are the optimal expression systems for producing recombinant cat KITLG?

While the search results don't specifically address feline KITLG expression systems, researchers can follow protocols established for human KITLG production. Based on human KITLG research, mammalian expression systems (such as HEK293 or CHO cells) are often preferred for producing recombinant KITLG to ensure proper folding and post-translational modifications. For functional studies of cat KITLG, similar experimental approaches can be employed to those used in human KITLG research, including:

  • PCR amplification of the feline KITLG gene from genomic DNA

  • Subcloning into an appropriate expression vector (such as pGL3-promoter for luciferase assays)

  • Transfection into mammalian cells using reagents like lipofectamine 2000

  • Protein expression at physiologically relevant temperatures (37°C or experimental conditions such as 31°C)

  • Purification using affinity chromatography techniques

What functional assays can be used to validate recombinant cat KITLG activity?

Several functional assays can validate recombinant cat KITLG activity, drawing from methodology used in human KITLG research:

  • Dual-Luciferase Reporter Assay: This technique has been successfully used to study human KITLG variants by subcloning KITLG sequences into the pGL3-promoter expression vector and measuring luciferase activity in cells like A375 (melanoma) and HEK293 .

  • Melanocyte Proliferation Assays: Given KITLG's role in melanocyte development, researchers can measure the proliferation rate of feline melanocytes in response to recombinant cat KITLG.

  • Melanin Content Analysis: Based on human studies showing that mutant sKITLG (Asn36Ser) increased melanin content by 109% compared to wild-type in human melanoma cells , similar assays can be developed for feline cells to measure melanin production in response to recombinant cat KITLG.

  • KIT Receptor Binding Assays: Measuring the binding affinity of recombinant cat KITLG to the feline KIT receptor using techniques such as surface plasmon resonance.

How conserved is KITLG between cats and other species, and what are the implications for cross-species studies?

While the search results don't provide direct information on feline KITLG conservation, evolutionary analysis of human KITLG provides a framework for understanding conservation patterns. Human KITLG shows evidence of positive selection, particularly in Eurasian populations, with selection signals detected in both upstream and downstream regions of the gene . Researchers studying cat KITLG should:

  • Conduct comparative sequence analysis between feline KITLG and orthologs from other species

  • Perform phylogenetic analysis to determine evolutionary relationships

  • Identify conserved functional domains that may indicate shared biological functions

  • Examine species-specific variations that might relate to unique phenotypic traits in cats

For cross-species studies, particularly close attention should be paid to conserved functional domains versus regions showing evidence of positive selection, as these may represent species-specific adaptations.

What approaches can be used to identify positive selection in feline KITLG similar to those identified in human populations?

To identify potential positive selection in feline KITLG, researchers can employ methodologies similar to those used in human studies:

  • Extended Haplotype Homozygosity (EHH) Test: This detects genetic imprints of recent positive selection by analyzing long-range haplotypes, as demonstrated in human studies where strong selection signals were identified in Europeans and East Asians .

  • XP-CLR Test: This can identify highly differentiated genomic regions as targets of selective sweeps by comparing feline populations from different geographical regions .

  • Additional Statistical Tests: Fay and Wu's H test, Fu and Li's test, and Tajima's D test can supplement the primary methods to validate selection signals .

  • Maximum-Likelihood Phylogenetic Trees: These can be constructed using KITLG sequence data from different cat populations to visualize evolutionary relationships and identify potential adaptive clades .

  • Haplotype Network Analysis: Median-joining algorithms can be used to analyze haplotype networks and identify potential selective events .

How can researchers investigate the role of cat KITLG in temperature adaptation similar to findings in human populations?

Human KITLG research has revealed temperature-responsive elements, with certain variants showing differential enhancer activities at lower temperatures (31°C vs. 37°C) . To investigate similar phenomena in cats:

  • Dual-Luciferase Reporter Assays at Variable Temperatures: Construct enhancer reporters containing cat KITLG regulatory regions and test their activities at different temperatures (e.g., 31°C and 37°C) in appropriate cell lines .

  • Identification of Temperature-Responsive Elements: Use bioinformatic approaches to identify potential temperature-responsive elements in the cat KITLG gene by comparing with known human elements.

  • Expression Analysis Across Environmental Conditions: Compare KITLG expression levels in feline cell lines or tissue samples under different temperature conditions.

  • Population Genetics in Diverse Climates: Analyze KITLG sequence variations in cat populations from different climatic regions to identify potential adaptations similar to those seen in human populations.

What methods can be used to study the epigenetic regulation of cat KITLG expression?

For investigating epigenetic regulation of cat KITLG, researchers can employ these methodological approaches:

  • Histone Modification Analysis: Search for enhancer-associated histone marks (H3K4me1) in feline cell lines, similar to the ENCODE database approaches used for human KITLG .

  • Methylation Analysis: Perform bisulfite sequencing to examine DNA methylation patterns in the promoter and enhancer regions of cat KITLG.

  • Chromatin Immunoprecipitation (ChIP): Use ChIP to identify transcription factors and other regulatory proteins that bind to cat KITLG regulatory regions.

  • Chromosome Conformation Capture (3C): Apply 3C techniques to understand the three-dimensional interactions between regulatory elements in the cat KITLG locus.

What is known about KITLG mutations in feline pigmentation disorders and how can recombinant KITLG help study these conditions?

While the search results don't provide specific information about feline pigmentation disorders related to KITLG, human studies offer valuable insights. In humans, heterozygous mutations in KITLG are responsible for Familial Progressive Hyper- and Hypopigmentation (FPHH), characterized by progressive, diffuse, partly blotchy hyperpigmented lesions intermingled with scattered hypopigmented spots, lentigines, and sometimes Cafe-au-lait spots .

To study potential similar conditions in cats:

  • Genetic Screening: Develop targeted sequencing panels for feline KITLG to identify potential mutations in cats with pigmentation abnormalities.

  • Functional Validation: Use recombinant cat KITLG (both wild-type and mutant versions) to validate the functional impact of identified mutations through in vitro assays.

  • Phenotype-Genotype Correlation: Establish relationships between specific KITLG variants and feline coat color patterns or pigmentation disorders.

  • Therapeutic Exploration: Investigate whether recombinant wild-type KITLG could potentially rescue phenotypes caused by loss-of-function mutations.

How can researchers use recombinant cat KITLG to study its role in feline stem cell and hematopoietic development?

Based on KITLG's known functions in other species, researchers can use recombinant cat KITLG to:

  • Hematopoietic Colony Assays: Evaluate the effect of recombinant cat KITLG on the formation of different hematopoietic colony types from feline bone marrow or cord blood.

  • Stem Cell Expansion Protocols: Develop optimized protocols for ex vivo expansion of feline hematopoietic stem cells using recombinant cat KITLG alone or in combination with other cytokines.

  • Differentiation Studies: Investigate how recombinant cat KITLG influences the differentiation trajectory of feline stem cells toward specific lineages.

  • Comparative Analysis: Compare the dose-response relationship and biological effects of feline versus human KITLG on cat stem cells to identify species-specific requirements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.