Recombinant Cat Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in stock. However, should you require a specific format, kindly indicate your preference in the order remarks. We will accommodate your request accordingly.
Lead Time
Delivery timelines may vary based on purchasing methods and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
Target Protein Sequence
MSVQGPQRRLLGSLNSTSPAAPRLGLAANQTGPRCLELSVPDGLFLGLGLVSVVENVLVV AAIAKNRNLHSPMYYFICCLAVSDLLVSVSSVLETAVMLLLEAGALAGRAAVVQRLDDII DVLVCGAMVSSLCFLGAIAVDRYISIFYALRYHSIVTLPRAWRAISAIWVASVLSSTLFI AYYDHTAVLLCLVSFFVAMLVLMAVLYVHMLARACQHARGIARLHKRQRPVHQGLGLKGA ATLTILLGIFFLCWGPFFLHLSLMVLCPRHPICGCVFKNFNLFLTLIICNSIVDPFIYAF RSQELRKTLQEVLLCSW
Uniprot No.

Target Background

Function
Receptor for MSH (alpha, beta, and gamma) and ACTH. This receptor's activity is mediated by G proteins that activate adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), via cAMP signaling regulation in melanocytes.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of feline MC1R and how does it differ from human MC1R?

Feline MC1R (Melanocortin 1 Receptor) is a G protein-coupled receptor expressed primarily in melanocytes. The protein structure includes seven transmembrane domains with an extracellular N-terminus and intracellular C-terminus. While the core structure is conserved across mammals, species-specific variations exist, particularly in the transmembrane and extracellular loop regions.

Human MC1R (Q01726) contains 317 amino acids, and comparative analysis with feline MC1R reveals approximately 85% sequence homology, with most variations occurring in the N-terminal region (amino acids 1-37) . These differences affect ligand binding affinity and downstream signaling efficiency. For experimental work with recombinant feline MC1R, researchers should note that antibodies developed against human MC1R may show cross-reactivity but might require validation for specificity in feline systems .

How does palmitoylation affect MC1R activity in melanocytes?

Palmitoylation is critical for MC1R signaling functionality. This post-translational modification involves the covalent attachment of palmitate to cysteine residues by protein acyltransferases, primarily ZDHHC13. Research demonstrates that MC1R signaling is critically dependent on palmitoylation, which enhances receptor stability at the cell membrane and facilitates interaction with downstream signaling molecules .

In experimental models, disruption of palmitoylation significantly impairs MC1R function, with studies showing that ZDHHC13-mediated palmitoylation strengthens the interaction between ZDHHC13 and MC1R, particularly important for MC1R variants associated with red hair color (RHC) . Palmitoylation status affects not only pigmentation pathways but also MC1R's protective role in DNA repair mechanisms after UV exposure, making it a critical consideration in both basic and translational research .

What ligands activate feline MC1R and how do they compare in binding affinity?

The primary physiological ligand for feline MC1R is α-melanocyte-stimulating hormone (α-MSH), a peptide hormone derived from proopiomelanocortin (POMC). In comparative binding assays, α-MSH demonstrates nanomolar affinity for the feline receptor, though the exact binding constants vary slightly from human MC1R.

Experimental studies have employed both natural α-MSH and synthetic analogs such as NDP-MSH (a superpotent analog) to activate MC1R signaling. When designing experiments with recombinant feline MC1R, researchers should consider that ligand binding induces multiple downstream pathways including:

  • cAMP signaling via adenylyl cyclase activation

  • MITF upregulation, which functions as a master regulator of pigmentation genes

  • Activation of DNA repair mechanisms that protect against UV damage

  • Anti-inflammatory effects through inhibition of NF-κB nuclear translocation

Each of these pathways can be experimentally monitored to assess receptor functionality, with cAMP elevation typically serving as the primary readout for successful activation.

What methods are most effective for characterizing MC1R genetic variants in cats?

Characterization of feline MC1R variants requires a systematic approach combining genomic analysis, functional assessment, and phenotypic correlation. Based on established protocols, researchers should consider the following methodological approach:

PCR-RFLP Analysis: Polymerase chain reaction-restriction fragment length polymorphism has proven effective for identifying MC1R variants. Primers targeting conserved regions flanking known polymorphic sites can be designed based on feline genome reference sequences. For example, specific restriction enzymes like SsiI can be used to distinguish between variants, producing characteristic fragment patterns when analyzed by gel electrophoresis .

Whole Genome Sequencing: For comprehensive variant discovery, high-coverage whole genome sequencing is recommended. Analysis workflows should include:

  • Library preparation using PCR-free methods to reduce bias

  • Sequencing at >40x coverage (45-52x has been successfully used in previous studies)

  • Variant calling using multiple algorithms (GATK, Freebayes, and Bcftools) to ensure comprehensive detection

  • Structural variant detection using tools like Lumpy, with visual verification via IGV

Haplotype Analysis: For narrowing candidate intervals containing functional MC1R variants, researchers should genotype multiple individuals (both expressing and non-expressing the phenotype of interest) across multiple SNV loci to identify recombination breakpoints and diagnostic markers .

These approaches have successfully identified causal variants in coat color studies, producing high-confidence results when properly implemented.

What expression systems are most effective for producing functional recombinant feline MC1R?

For researchers working with recombinant feline MC1R, the expression system selection significantly impacts protein quality and functionality. Based on published protocols, the following recommendations can guide system selection:

Mammalian Expression Systems: HEK293 or CHO cells generally yield properly folded, post-translationally modified MC1R with native-like function. These systems properly process the seven transmembrane domains and facilitate palmitoylation crucial for receptor function . For most functional studies, mammalian expression represents the gold standard approach.

Insect Cell Systems: Sf9 or High Five™ cells using baculovirus vectors offer higher protein yields while maintaining most post-translational modifications. This system provides a good compromise between yield and functionality for structural studies or antibody production.

Bacterial Systems: While E. coli systems can produce fragments or domains of MC1R for specific applications (such as antibody generation), they generally fail to properly fold the complete receptor or provide necessary post-translational modifications like palmitoylation that are critical for function .

For functional verification, receptor activity can be assessed using cAMP accumulation assays, calcium mobilization, or ERK phosphorylation following α-MSH stimulation. Western blotting with anti-MC1R antibodies (validated for feline specificity) can confirm expression, while cell surface biotinylation assays verify proper membrane localization .

What experimental approaches best demonstrate MC1R's role in DNA damage repair?

MC1R plays a significant protective role in chromosome stability and centromeric integrity following UV exposure. To investigate this function experimentally, researchers should consider the following approaches:

Metaphase Spread Chromosome Analysis: This technique effectively visualizes chromosome instability. Human primary melanocytes with MC1R silencing showed increased UV-induced chromosome instability in Giemsa-stained metaphase spreads . The protocol should include:

  • Treatment of melanocytes with UV radiation (typically UVB at doses of 10-20 mJ/cm²)

  • Colcemid treatment to arrest cells in metaphase

  • Hypotonic swelling and fixation

  • Giemsa staining and microscopic analysis of chromosome abnormalities

Quantification of DNA Damage Markers: Immunofluorescence staining for γH2AX foci or cyclobutane pyrimidine dimers (CPDs) can quantitatively assess DNA damage and repair efficiency in cells with manipulated MC1R expression or activity.

Cell Cycle Analysis: Flow cytometry-based assessment of cell cycle distribution following UV exposure reveals MC1R's role in regulating G1-like cell cycle arrest and premature senescence, which functions as a tumor-suppressive mechanism .

ZDHHC13 Phosphorylation Assays: Since AMPK-mediated phosphorylation of ZDHHC13 at S208 enhances MC1R palmitoylation and function, phospho-specific antibodies or mass spectrometry can track this modification in experimental settings .

These techniques collectively provide a comprehensive evaluation of MC1R's non-pigmentary functions, particularly relevant for understanding its role in melanoma prevention.

How do MC1R variants influence downstream signaling in feline melanocytes?

MC1R variants significantly alter downstream signaling cascades in melanocytes, affecting both pigmentation and non-pigmentary functions. The signaling differences between variants can be examined through several experimental approaches:

Gene Expression Analysis: qRT-PCR assessment of MC1R transcriptional targets reveals that variants associated with orange coat color show significantly reduced expression of key pigmentation genes, including Dct, Mitf, Pmel, and Tyrp1 . This pattern mirrors mouse models with impaired MC1R signaling, suggesting conserved mechanisms across species.

cAMP Signaling Assessment: Since MC1R couples to adenylyl cyclase via Gs proteins, variants show different capacities to elevate intracellular cAMP levels upon α-MSH stimulation. Researchers can quantify these differences using ELISA-based cAMP detection kits or FRET-based real-time sensors in live cells.

Palmitoylation Efficiency: MC1R variants show differences in palmitoylation efficiency, which can be assessed using metabolic labeling with palmitate analogs followed by click chemistry detection or acyl-biotin exchange (ABE) assays. The RHC-associated variants typically show reduced palmitoylation, though this can be partially rescued by enhancing ZDHHC13 activity through AMPK-mediated phosphorylation .

DNA Repair Capacity: Functional assays measuring repair of UV-induced DNA damage (particularly CPDs and 6-4PPs) demonstrate that MC1R variants differ in their ability to promote efficient damage repair. This explains the elevated melanoma risk associated with certain variants independent of pigmentation phenotypes .

These signaling differences provide valuable insights into how MC1R variations influence both normal physiology and disease susceptibility.

What is the relationship between AMPK, ZDHHC13, and MC1R in regulating melanocyte function?

The AMPK-ZDHHC13-MC1R regulatory axis represents a critical mechanism controlling melanocyte responses to environmental stressors. This pathway can be experimentally characterized through several approaches:

AMPK functions as a cellular energy sensor that, when activated, phosphorylates ZDHHC13 at serine 208 . This phosphorylation enhances ZDHHC13's ability to palmitoylate MC1R, particularly MC1R variants associated with red hair color (RHC) that typically exhibit reduced function. The strengthened interaction between phosphorylated ZDHHC13 and MC1R-RHC leads to enhanced palmitoylation, improving receptor stability and signaling capacity .

Experimental demonstration of this pathway includes:

  • Co-immunoprecipitation assays showing enhanced ZDHHC13-MC1R interaction following AMPK activation

  • Palmitoylation assays demonstrating increased MC1R modification after AMPK activation

  • Functional readouts of MC1R activity (cAMP elevation, MITF induction) showing enhancement by AMPK activators

  • Site-directed mutagenesis of ZDHHC13 S208 abolishing the effect of AMPK activation

The biological significance of this regulatory mechanism is substantial - AMPK activation and subsequent enhancement of MC1R palmitoylation suppresses UVB-induced transformation of human melanocytes in vitro and delays melanomagenesis in vivo in mouse models . This suggests AMPK activators could represent a preventive strategy for melanoma, especially in individuals with RHC variants.

How does α-MSH/MC1R signaling regulate inflammatory pathways?

The α-MSH/MC1R signaling axis exerts significant anti-inflammatory effects independent of its role in pigmentation. These effects operate through several mechanisms that can be experimentally demonstrated:

Inhibition of NF-κB Nuclear Translocation: α-MSH potently inhibits the nuclear translocation of NF-κB induced by inflammatory stimuli such as TNF-α. Experimental evidence shows that α-MSH treatment causes retention of NF-κB in the cytoplasm, preventing its transcriptional activities. This can be visualized using immunofluorescence microscopy tracking p65 localization or fractionation experiments separating nuclear and cytoplasmic compartments .

Repression of NF-κB-Dependent Gene Expression: Using reporter gene assays with the MDR promoter containing NF-κB binding sites linked to CAT (chloramphenicol acetyltransferase), researchers have demonstrated that α-MSH pretreatment reduces TNF-induced reporter activity by approximately 90% . This confirms that MC1R activation functionally inhibits NF-κB-mediated transcription.

Anti-Inflammatory Cytokine Profile: MC1R activation alters the profile of inflammatory mediators produced by melanocytes and immune cells, favoring anti-inflammatory cytokines. Quantitative analyses of cytokine production (using ELISA, cytokine arrays, or qRT-PCR) can characterize this immunomodulatory effect.

These anti-inflammatory properties position MC1R signaling as a potential therapeutic target for inflammatory skin conditions and may explain some of the non-pigmentary benefits of α-MSH analogs in clinical development.

How can recombinant feline MC1R be used to study chromosome stability mechanisms?

Recombinant feline MC1R provides a valuable tool for investigating chromosome stability mechanisms, particularly following UV exposure. Research has established that MC1R plays a protective role in maintaining chromosome stability and centromeric integrity after UV irradiation in melanocytes . This function is distinct from its pigmentary role and depends on palmitoylation status.

Experimental approaches using recombinant MC1R include:

Complementation Studies: Recombinant wildtype or variant MC1R can be expressed in MC1R-silenced melanocytes to determine which domains and post-translational modifications are essential for chromosome stability. Giemsa staining and metaphase spread chromosome analysis provide readouts of cytogenetic alterations .

Molecular Mechanism Exploration: MC1R signaling affects centromere stability, as evidenced by observations of lagging chromosomes and anaphase bridges in UVR-treated melanocytes with MC1R depletion . Co-expression of recombinant MC1R with centromeric proteins can identify direct or indirect interactions that maintain centromere function.

MITF Dependency Analysis: Research shows that MITF is a critical downstream factor in MC1R-controlled chromosome stability. When MITF is silenced, α-MSH stimulation fails to prevent UVR-induced chromosome instability, while MITF overexpression rescues chromosome stability in cells with MC1R silencing . Recombinant MC1R can be used to map signaling pathways connecting the receptor to MITF activation.

These approaches not only illuminate fundamental mechanisms of genome maintenance but also suggest therapeutic strategies for preventing MC1R deficiency-associated malignancies.

What methodologies can detect and quantify MC1R palmitoylation in experimental settings?

Palmitoylation is critical for MC1R function, making its detection and quantification essential for MC1R research. Several complementary methodologies provide comprehensive analysis of this post-translational modification:

Metabolic Labeling with Palmitate Analogs: Cells expressing recombinant MC1R can be labeled with alkyne or azide-modified palmitate analogs, followed by copper-catalyzed azide-alkyne cycloaddition (click chemistry) to attach detectable tags (fluorophores or biotin). This approach enables visualization and quantification of newly palmitoylated receptor.

Acyl-Biotin Exchange (ABE) Assay: This non-radioactive method involves:

  • Blocking free thiols with N-ethylmaleimide

  • Cleaving thioester bonds with hydroxylamine

  • Biotinylating newly exposed thiols

  • Purifying biotinylated proteins with streptavidin

  • Detecting MC1R by western blotting

This technique quantifies the stoichiometry of palmitoylation and can identify specific palmitoylated cysteines when combined with mass spectrometry.

Mass Spectrometry: For site-specific analysis, purified MC1R can be digested and analyzed by liquid chromatography-tandem mass spectrometry (LC-MS/MS). This approach precisely identifies modified residues and can be quantitative when using stable isotope labeling strategies.

Palmitoylation Inhibition Studies: Pharmacological inhibitors of palmitoylation (e.g., 2-bromopalmitate) or genetic manipulation of ZDHHC13 can assess functional consequences of palmitoylation loss. Subsequent functional assays (cAMP production, DNA repair capacity) correlate palmitoylation status with receptor activity .

These methods collectively provide a robust toolkit for investigating how palmitoylation regulates MC1R biology in both normal and pathological contexts.

How does phosphorylation of ZDHHC13 by AMPK affect MC1R palmitoylation and downstream signaling?

The AMPK-ZDHHC13-MC1R signaling axis represents a critical regulatory mechanism with implications for melanoma prevention. Detailed experimental evidence has elucidated the molecular events in this pathway:

AMPK, when activated by cellular stressors or pharmacological agents, phosphorylates ZDHHC13 specifically at serine 208 . This phosphorylation event significantly enhances ZDHHC13's interaction with MC1R, particularly with RHC-variants that typically exhibit reduced function. The strengthened protein-protein interaction results in more efficient palmitoylation of MC1R, which stabilizes the receptor at the plasma membrane and enhances its signaling capacity .

Experimental data demonstrates this mechanism through several approaches:

Experimental ApproachKey FindingsImplications
Co-immunoprecipitationPhosphorylated ZDHHC13 shows enhanced binding to MC1R-RHC variantsProvides mechanistic explanation for rescue of variant receptor function
Palmitoylation assaysAMPK activation increases MC1R palmitoylation levelsConfirms functional outcome of enhanced ZDHHC13-MC1R interaction
cAMP signalingAMPK activation enhances α-MSH-induced cAMP productionDemonstrates functional improvement in primary MC1R signaling pathway
DNA repair assaysAMPK activation improves repair of UVB-induced DNA damageLinks pathway to cancer prevention mechanisms
Melanocyte transformationAMPK activation repressed UVB-induced melanocyte transformationSupports therapeutic potential for melanoma prevention

The biological significance extends to clinical observations, as AMPK upregulation in human melanomas correlates with expression of factors downstream from MC1R signaling and with prolonged patient survival . This suggests that AMPK activators (such as metformin or AICAR) could potentially reduce melanoma risk, especially in individuals with red hair color phenotypes.

How do feline MC1R variants compare to those in other species regarding coat color determination?

Comparative analysis of MC1R variants across species reveals both conserved and divergent mechanisms controlling coat color phenotypes:

In domestic cats, the sex-linked orange mutation causes variegated patches of reddish/yellow hair and serves as a defining signature of random X-inactivation . This contrasts with MC1R variants in other species that are typically autosomal and show different inheritance patterns. Molecular characterization has identified that the orange phenotype in cats is associated with altered Arhgap36 expression, which affects MC1R signaling indirectly by inhibiting production of eumelanin (black/brown pigment) and favoring pheomelanin (yellow/red pigment) .

In cattle, MC1R polymorphisms directly affect receptor function and are characterized using PCR-RFLP analysis with specific restriction enzymes like Cfr10I and SsiI . The resulting genotypes (ED/ED, ED/E+, E+/E+, ED/e, E+/e, e/e) correlate with specific coat color phenotypes, with the e allele typically associated with red coat color .

In humans, MC1R variants (particularly RHC variants) affect not only hair and skin pigmentation but also DNA repair capacity and melanoma susceptibility . These variants show reduced function that can be partially rescued through enhancement of receptor palmitoylation .

Comparative studies of these variants provide evolutionary insights into pigmentation biology and reveal convergent and divergent mechanisms of coat color determination across mammalian species.

What techniques are most effective for cross-species functional comparison of MC1R variants?

For researchers conducting comparative studies of MC1R across species, several specialized techniques enable meaningful functional comparisons:

Heterologous Expression Systems: Expressing MC1R variants from different species in a common cellular background (typically HEK293 cells) allows direct comparison of receptor properties. Key parameters to measure include:

  • Ligand binding affinities using radioligand binding assays

  • cAMP response curves following α-MSH stimulation

  • Cell surface expression levels using biotinylation assays

  • Palmitoylation efficiency using click chemistry approaches

Chimeric Receptor Analysis: Creating chimeric receptors that combine domains from different species helps identify which regions contribute to species-specific functional differences. This approach has successfully mapped ligand binding domains and coupling efficiency determinants.

Comparative Genomics and Evolutionary Analysis: Sequence comparison across species should incorporate:

  • Multiple sequence alignment of MC1R coding sequences

  • Calculation of selection pressures (dN/dS ratios) to identify conserved functional domains

  • Ancestral sequence reconstruction to track evolutionary changes

  • Identification of species-specific regulatory elements using comparative genomics

CRISPR-Based Species Substitution: Modern genome editing techniques allow researchers to replace endogenous MC1R with variants from other species in cellular or even organismal models, providing the most direct test of functional conservation or divergence.

These approaches collectively provide insights into both the conserved core functions of MC1R and the species-specific adaptations that have evolved to meet different environmental challenges.

How can MC1R research contribute to melanoma prevention strategies?

MC1R research offers several promising avenues for melanoma prevention, particularly for individuals with MC1R variants associated with increased melanoma risk:

AMPK Activation Strategies: Research has demonstrated that AMPK phosphorylates ZDHHC13 at S208, enhancing MC1R palmitoylation and signaling even in receptor variants associated with red hair color . AMPK activation repressed UVB-induced transformation of human melanocytes in vitro and delayed melanomagenesis in vivo in mouse models . These findings suggest that AMPK activators (such as metformin, already approved for diabetes treatment) could potentially reduce melanoma risk in susceptible populations.

Palmitoylation Enhancement: Direct targeting of palmitoylation machinery represents another approach. Since MC1R function is critically dependent on palmitoylation mediated by ZDHHC13 , compounds that enhance this post-translational modification could improve receptor function and DNA repair capacity.

DNA Repair Pathway Augmentation: MC1R promotes efficient repair of UVB-induced DNA damage products like cyclobutane pyrimidine dimers (CPD) and 6–4 photoproducts . Developing approaches to enhance these repair pathways independent of MC1R could bypass the receptor deficiency in individuals with variant alleles.

Cell Cycle Checkpoint Reinforcement: MC1R regulates UVB-induced G1-like cell cycle arrest and subsequent premature senescence, which functions as a tumor-suppressive mechanism . Targeting these downstream pathways could provide protection even when MC1R signaling is compromised.

These approaches build on detailed molecular understanding of MC1R biology and offer potential translational applications to reduce melanoma incidence, particularly in high-risk populations.

What role does MC1R play in inflammatory responses through NF-κB pathway modulation?

Beyond its well-established role in pigmentation, MC1R signaling exerts significant anti-inflammatory effects through modulation of the NF-κB pathway. This function has important implications for both normal physiology and disease states.

Experimental evidence demonstrates that α-MSH treatment inhibits the nuclear translocation of NF-κB induced by inflammatory stimuli such as TNF-α . This mechanism involves maintaining NF-κB in an inactive cytoplasmic state by preventing its dissociation from inhibitory IκB proteins. Reporter gene assays using the MDR promoter containing NF-κB binding sites linked to CAT show that α-MSH pretreatment reduces TNF-induced reporter activity by approximately 90% .

The physiological significance of this regulatory mechanism extends to:

  • Protection against UV-induced inflammation in skin

  • Modulation of inflammatory responses in melanocytic lesions

  • Potential therapeutic applications for inflammatory skin conditions

Research techniques to explore this function include:

  • Electrophoretic mobility shift assays (EMSA) to assess NF-κB DNA binding

  • Immunofluorescence microscopy to track p65 nuclear translocation

  • ChIP-seq to identify genome-wide effects on NF-κB binding

  • RNA-seq to characterize the inflammatory transcriptome regulated by MC1R

This non-pigmentary function of MC1R represents an evolving area of research with potential therapeutic applications beyond the traditional focus on melanin production and photoprotection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.