Recombinant Cat NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of MT-ND3

MT-ND3 is a gene of the mitochondrial genome that codes for NADH dehydrogenase 3 (ND3) protein . This protein serves as a critical subunit of NADH dehydrogenase (ubiquinone), situated within the mitochondrial inner membrane and functioning as the largest of the five complexes in the electron transport chain . The fundamental importance of MT-ND3 lies in its role in maintaining oxidative phosphorylation, the process by which cells generate the majority of their adenosine triphosphate (ATP) during cellular respiration.

In mammalian species, including cats, MT-ND3 exhibits high conservation across evolutionary lines, reflecting its essential function in cellular metabolism. The gene produces a protein approximately 13 kDa in size composed of 115 amino acids in humans, with similar characteristics expected in feline species . The protein is characterized by its highly hydrophobic nature, allowing it to integrate effectively within the lipid bilayer of the mitochondrial inner membrane.

MT-ND3 functions as one of seven mitochondrially encoded subunits of Complex I, working alongside MT-ND1, MT-ND2, MT-ND4, MT-ND4L, MT-ND5, and MT-ND6 to form the core of this vital respiratory complex . This complex possesses a distinctive L-shaped structure consisting of a hydrophobic transmembrane domain and a hydrophilic peripheral arm containing redox centers and the NADH binding site . Within this structure, MT-ND3 and other mitochondrially encoded components form the essential transmembrane core that anchors the complex within the inner mitochondrial membrane.

Production of Recombinant MT-ND3

Recombinant MT-ND3 proteins are typically produced using bacterial expression systems, with Escherichia coli being the predominant host organism. Similar to other recombinant MT-ND3 variants, the cat version would likely be produced using comparable methodologies. The production process involves cloning the full-length MT-ND3 gene sequence, introducing it into an expression vector with an appropriate tag (commonly a histidine tag), and expressing the protein in a bacterial host .

The resulting recombinant protein undergoes purification processes, typically involving affinity chromatography leveraging the histidine tag. Following purification, the protein is commonly prepared as a lyophilized powder for stability and storage purposes . The recombinant protein production methodology yields highly purified protein preparations, generally exceeding 90% purity as verified through sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis .

Research Applications of Recombinant MT-ND3

Recombinant MT-ND3 serves numerous valuable research purposes across multiple scientific disciplines. The availability of purified recombinant protein facilitates detailed structural studies, functional analyses, and antibody development. These research tools enable investigators to probe the role of MT-ND3 in normal mitochondrial function and in disease states.

Antibody Development and Validation

One significant application of recombinant MT-ND3 is in the development and validation of antibodies targeted against this protein. Commercial antibodies are available for detecting MT-ND3, with applications primarily in western blotting . These antibodies exhibit high specificity and can detect endogenous levels of MT-ND3 protein, which typically appears at approximately 13 kDa on western blots . Such antibodies represent essential tools for investigating the expression, localization, and interactions of MT-ND3 in various experimental contexts.

Mitochondrial Base Editing Research

Recombinant MT-ND3 has proven invaluable in cutting-edge research involving mitochondrial genome editing. Recent studies have utilized DdCBE (DddA-derived cytosine base editors) paired with TALE (transcription activator-like effector) domains to target specific cytosine residues within the MT-ND3 gene . These experiments have demonstrated successful editing of targeted cytosines in the conserved ND3 loop, which is involved in the active/deactive state transition of Complex I . Such research approaches offer promising avenues for investigating MT-ND3 function through precise genetic manipulation.

Therapeutic Target Exploration

MT-ND3 has emerged as a promising target for therapeutic interventions, particularly in the context of diabetic cognitive impairment. Research has identified that 2-hydroxyisobutyric acid (2-HIBA) can bind to MT-ND3, enhancing mitochondrial respiratory chain homeostasis in the hippocampus . This interaction leads to increased MT-ND3 content and improved cognitive function in diabetic mouse models . Such findings highlight the potential of recombinant MT-ND3 in drug discovery platforms targeting mitochondrial dysfunction in neurological disorders.

Clinical Significance and Disease Associations

MT-ND3 carries significant clinical relevance due to its association with several mitochondrial disorders. Pathogenic variants in the MT-ND3 gene are linked to a spectrum of clinical manifestations, including mitochondrial complex I deficiency (MT-C1D), which can manifest as Leigh syndrome, Leber hereditary optic neuropathy, and various forms of encephalopathy .

Mitochondrial Disorders Associated with MT-ND3 Mutations

Mutations in MT-ND3 can disrupt the assembly and function of Complex I, leading to impaired oxidative phosphorylation and compromised cellular energy production. The table below summarizes key mitochondrial disorders associated with MT-ND3 mutations:

DisorderClinical FeaturesMT-ND3 Involvement
Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes (MELAS)Stroke-like episodes, lactic acidosis, encephalopathyMT-ND3 mutations disrupt Complex I activity
Leigh Syndrome (LS)Progressive neurodegeneration, respiratory abnormalitiesMT-ND3 variants affect energy production in neural tissues
Leber's Hereditary Optic Neuropathy (LHON)Acute or subacute painless central vision lossMT-ND3 mutations impair optic nerve function
Mitochondrial Complex I Deficiency (MT-C1D)Variable presentation, often with neurological symptomsDirect result of dysfunctional MT-ND3

These disorders highlight the critical importance of MT-ND3 in maintaining proper mitochondrial function and cellular energy homeostasis. The availability of recombinant MT-ND3 provides researchers with tools to investigate the molecular mechanisms underlying these disorders and develop potential therapeutic strategies.

Future Research Directions

The field of MT-ND3 research continues to evolve, with several promising directions for future investigation. The availability of high-quality recombinant cat MT-ND3 would facilitate comparative studies across species, potentially revealing evolutionary adaptations in mitochondrial function. Additionally, recombinant MT-ND3 could serve as a valuable tool for screening potential therapeutic compounds targeting mitochondrial dysfunction.

Emerging research suggests that MT-ND3 represents a promising drug target for preventing nerve damage in hyperglycemic environments . The development of compounds that modulate MT-ND3 function or stability could lead to novel therapeutic approaches for treating diabetic cognitive impairment and other neurodegenerative conditions associated with mitochondrial dysfunction.

The application of advanced mitochondrial genome editing techniques, such as those demonstrated with DdCBE in mouse models , offers exciting possibilities for investigating MT-ND3 function through precise genetic manipulation. These approaches could provide valuable insights into the role of specific amino acid residues in MT-ND3 function and potentially lead to new strategies for addressing mitochondrial disorders.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please include your preference in the order notes, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to minimize freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
Full length protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
Target Protein Sequence
MNVMLALLTNTLLSTLLVLIAFWLPQLNIYAEKASPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWASQTDKLPTMLTMALLLISLLAASLAYEWTQKGLEWTE
Uniprot No.

Target Background

Function
Recombinant Cat NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. MT-ND3 is essential for the catalytic activity of complex I.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its role in mitochondrial function?

MT-ND3 (Mitochondrially Encoded NADH:Ubiquinone Oxidoreductase Core Subunit 3) is a core component of Complex I in the mitochondrial respiratory chain. It functions as an essential subunit of NADH dehydrogenase, which catalyzes electron transfer from NADH through the respiratory chain using ubiquinone as an electron acceptor . The protein is encoded by mitochondrial DNA, spanning positions 10,059 to 10,404 in the human mitochondrial genome, and produces a 13 kDa protein composed of 115 amino acids . MT-ND3 is particularly critical as it assists in proton translocation across the mitochondrial membrane, which is indispensable for generating the electrochemical gradient used in ATP synthesis . Research methodologies should account for MT-ND3's hydrophobic nature, as it forms part of the core transmembrane region of Complex I .

How is MT-ND3 structurally integrated into Complex I?

MT-ND3 is one of seven mitochondrially-encoded subunits of Complex I (NADH dehydrogenase). Complex I has an L-shaped structure with a long hydrophobic transmembrane domain and a hydrophilic peripheral arm containing redox centers and the NADH binding site . MT-ND3 and other mitochondrially-encoded subunits are highly hydrophobic and form the core of the transmembrane region of Complex I . When designing experiments to study interactions between MT-ND3 and other components of Complex I, researchers should consider specialized techniques for membrane proteins, including detergent-based extraction methods, blue native PAGE, or cryo-electron microscopy. The integration of MT-ND3 into the complex is essential for its catalytic activity, as this subunit has been demonstrated to be required for proper Complex I function .

What antibody-based techniques are most effective for studying MT-ND3?

Several antibody-based techniques have proven effective for MT-ND3 research. Immunohistochemistry with paraffin-embedded tissues (IHC-P) and immunocytochemistry/immunofluorescence (ICC/IF) are validated methods for MT-ND3 detection . When selecting antibodies, rabbit polyclonal antibodies against human MT-ND3 have shown good results, particularly those targeting the first 100 amino acids of the protein .

For immunohistochemistry protocols:

  • Use paraffin-embedded tissues, sectioned at 4-6 μm thickness

  • Apply MT-ND3 antibodies at optimized dilutions (e.g., 1/20 dilution for paraffin sections)

  • Include appropriate positive controls such as human rectum tissue which shows good MT-ND3 expression

For immunofluorescence analysis:

  • Fix and permeabilize cells (e.g., PFA/Triton X-100 method for MCF7 cells)

  • Apply MT-ND3 antibodies at approximately 4 μg/mL concentration

  • Use appropriate fluorescent secondary antibodies for visualization

These methods allow visualization of MT-ND3 localization and expression patterns in various tissues and cell types, facilitating studies on mitochondrial distribution and potential alterations in disease states.

How can researchers effectively detect and quantify MT-ND3 mutations?

For detection and quantification of MT-ND3 mutations, several molecular approaches have proven effective:

  • PCR and Sanger Sequencing: This remains an important method for identifying SNPs and genotyping. Design primers flanking the MT-ND3 gene region (e.g., forward primer 5′-CCACAACTCAACGGCTACAT-3′ and reverse primer 5′-TGGGTGTTGAGGGTTATGAG-3′) . PCR products can be directly sequenced using the same primers with standard dye terminator chemistry.

  • Next-Generation Sequencing (NGS): This allows for accurate quantification of heteroplasmic mutations due to the ability to count individual sequencing reads. Map sequenced reads to the mitochondrial reference genome (e.g., NC_012920 for human) using appropriate alignment tools such as Burrows-Wheeler Aligner, and identify variants using tools like Genome Analysis Toolkit .

  • Heteroplasmy Quantification: For mitochondrial mutations, it's crucial to determine the mutant load (percentage of mitochondrial genomes carrying the mutation). NGS methods allow calculation of mutant load by counting the number of mtDNA reads containing the variant versus total reads at that position .

Data analysis should include:

  • Filtering variants using quality parameters

  • Calculating percentage of heteroplasmy

  • Statistical analysis of correlations between mutant load and phenotypic characteristics

Recent studies analyzing MT-ND3 mutations such as m.10191T>C and m.10158T>C found mutant loads ranging from 57.9% to 93.6%, with a median value of 82.5% . The correlation between mutant load and disease onset or severity should be statistically evaluated (e.g., using Pearson correlation coefficients) .

What is the role of MT-ND3 mutations in Leigh Syndrome?

MT-ND3 mutations represent an important cause of Leigh Syndrome, a severe neurodegenerative disorder. The m.10191T>C mutation in MT-ND3 is particularly significant and has been strongly associated with both Leigh Syndrome and epilepsy . Research methodologies for studying this connection include:

  • Clinical phenotyping: Document detailed neurological presentations, including seizure types, EEG findings, and neuroimaging results. In a study of seven patients with Leigh Syndrome with MT-ND3 mutations, six carried the m.10191T>C mutation and all six of these patients developed epilepsy, with three progressing to Lennox-Gastaut syndrome .

  • Genotype-phenotype correlation analysis: Investigate whether mutant load correlates with disease severity, age of onset, or specific symptoms. Current data suggests variable correlation between mutant load and clinical features (r=0.470, p=0.347 for first symptom onset vs. first seizure; r=0.523, p=0.287 for first symptom onset vs. mutant load; r=0.374, p=0.465 for first seizure onset vs. mutant load) .

  • Functional studies: Assess the impact of MT-ND3 mutations on:

    • Complex I assembly and activity

    • ATP production

    • Reactive oxygen species generation

    • Mitochondrial membrane potential

  • Therapeutic approaches: All patients in documented studies received mitochondrial cocktail treatments (coenzyme Q10, L-carnitine, and multivitamins) from the time of diagnosis . Research should focus on comparing treatment efficacy in MT-ND3-related Leigh Syndrome versus other genetic causes.

How do MT-ND3 polymorphisms contribute to cancer susceptibility?

MT-ND3 polymorphisms have been implicated in increased cancer susceptibility, particularly in gastric cancer (GC). Research methods for investigating this association include:

  • Case-control studies: Compare MT-ND3 polymorphism frequencies between cancer patients and healthy controls. A study examining MT-ND3 polymorphisms in gastric cancer found several significant associations, with adjusted odds ratios (OR) indicating increased risk .

  • SNP identification workflow:

    • PCR amplification of MT-ND3 region

    • Sanger sequencing of PCR products

    • Sequence analysis based on reference sequence (e.g., human MT:10398, GenBank accession number: NC_012920)

  • Statistical analysis methods:

    • Calculate adjusted odds ratios (OR) with 95% confidence intervals (CI)

    • Stratify analysis by tumor characteristics (stage, grade, histologic type)

    • Perform subgroup analyses by age, sex, and other clinical features

  • Mechanistic studies: Investigate how specific MT-ND3 variants affect:

    • ROS production (as seen in the rs2853826 polymorphism)

    • Mitochondrial function and energy metabolism

    • Cellular proliferation and apoptotic pathways

Particularly relevant are the rs28358278, rs2853826, and rs41467651 polymorphisms, which have been associated with increased susceptibility to gastric cancer development . Research indicates these polymorphisms may be stage-specific, with adjusted OR = 2.36 (95% CI = 1.12-5.13, P = 0.025) in tumor stage III subjects compared to controls .

How do nuclear-encoded factors interact with MT-ND3 in Complex I assembly?

Although MT-ND3 is encoded by mitochondrial DNA, its integration into Complex I requires coordinated interaction with nuclear-encoded subunits and assembly factors. Research approaches to study these interactions include:

  • Co-immunoprecipitation studies: Use antibodies against MT-ND3 to pull down interacting proteins, followed by mass spectrometry identification.

  • Blue native PAGE: This technique preserves protein complexes and allows visualization of assembly intermediates containing MT-ND3.

  • Inducible knockdown/knockout models: Develop systems to modulate expression of suspected nuclear-encoded interaction partners and assess effects on:

    • MT-ND3 stability

    • Complex I assembly

    • Mitochondrial function

  • Proximity labeling techniques: Methods such as BioID or APEX2 can identify proteins in close spatial proximity to MT-ND3 in living cells.

Analysis of MT-ND3's role in Complex I should recognize that this subunit is essential for the catalytic activity of the complex . The highly hydrophobic nature of MT-ND3 necessitates specialized techniques when studying its interactions with other proteins, particularly those involved in membrane insertion and assembly.

What are the challenges in developing therapeutic approaches targeting MT-ND3-related disorders?

Developing therapies for MT-ND3-related disorders presents several unique challenges requiring specialized research approaches:

  • Heteroplasmy considerations: MT-ND3 mutations often exist in a heteroplasmic state with varying mutant loads across tissues. Therapeutic strategies must account for this heterogeneity. Research should:

    • Quantify tissue-specific heteroplasmy levels using NGS approaches

    • Determine threshold effects (minimum mutant load causing dysfunction)

    • Develop tissue-targeted delivery systems

  • Mitochondrial delivery challenges: Therapies must cross both cellular and mitochondrial membranes. Current research approaches include:

    • Mitochondria-targeted peptides (MTPs)

    • Lipophilic cations (e.g., triphenylphosphonium)

    • Mitochondria-targeted CRISPR systems

  • Functional assessment methodologies:

    • Oxygen consumption rate measurements

    • ATP production assays

    • Mitochondrial membrane potential analysis

    • ROS detection assays

  • Model systems for therapeutic testing:

    • Patient-derived fibroblasts

    • Cybrid cell lines with specific MT-ND3 mutations

    • Mouse models with MT-ND3 mutations (challenging due to mitochondrial genetics)

    • iPSC-derived neurons or organoids for neurological phenotypes

Current standard treatments for MT-ND3-related disorders like Leigh Syndrome involve mitochondrial cocktails including coenzyme Q10, L-carnitine, and multivitamins , but evidence for their efficacy remains limited. Research must focus on developing quantitative outcome measures to accurately assess therapeutic efficacy in these complex disorders.

How does MT-ND3 structure and function vary across species?

MT-ND3 shows interesting evolutionary patterns across species that provide insights for comparative research. When studying feline MT-ND3 in comparison to human or other species:

  • Sequence analysis approaches:

    • Multiple sequence alignment of MT-ND3 across species

    • Identification of conserved functional domains

    • Analysis of selection pressure using dN/dS ratios

  • Structural considerations:

    • MT-ND3 is approximately 115 amino acids in humans, forming a hydrophobic protein critical to the transmembrane domain of Complex I

    • Comparative analysis should focus on conservation of transmembrane domains

  • Unique evolutionary features:

    • In many species of birds and turtles, MT-ND3 contains an extra nucleotide that is not translated to protein

    • Translational frameshifting or RNA editing mechanisms maintain reading frame functionality despite this extra nucleotide

  • Functional conservation testing:

    • Respirometry to compare Complex I activity across species

    • Complementation studies in cell lines

Understanding the species-specific variations in MT-ND3 is crucial when developing animal models for human diseases, especially when considering feline models for studying mitochondrial disorders. The high conservation of functional domains across species suggests fundamental importance to cellular respiration, though species-specific differences may account for metabolic variations.

What methods are most effective for studying recombinant MT-ND3 expression?

Expressing recombinant MT-ND3 presents unique challenges due to its hydrophobic nature and mitochondrial origin. Effective methodological approaches include:

  • Expression system selection:

    • Bacterial systems: E. coli strains specialized for membrane proteins (C41, C43)

    • Eukaryotic systems: Yeast (S. cerevisiae, P. pastoris) may provide better folding

    • Cell-free systems: Allow direct incorporation into artificial membranes

  • Fusion partners and tags:

    • N-terminal fusion with soluble proteins (MBP, GST)

    • Addition of purification tags (His, FLAG)

    • Use of self-cleaving intein systems

  • Solubilization and purification strategies:

    • Detergent screening (mild detergents like DDM, LMNG)

    • Amphipol or nanodisc reconstitution

    • On-column refolding protocols

  • Functional validation approaches:

    • Blue native PAGE to assess complex formation

    • Electron transport activity measurements

    • Circular dichroism to confirm secondary structure

When working with recombinant cat MT-ND3 specifically, codon optimization for the expression system should account for feline mitochondrial codon usage. Additionally, researchers should consider species-specific antibody validation, as commercially available antibodies are typically designed against human MT-ND3, though cross-reactivity may exist due to sequence conservation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.