Recombinant Cat NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

MT-ND4L is a mitochondrial gene encoding a transmembrane protein critical for Complex I function. Complex I transfers electrons from NADH to ubiquinone, driving ATP synthesis via oxidative phosphorylation . The ND4L subunit is hydrophobic and contributes to the transmembrane domain of Complex I .

Key Features:

  • Gene Location: Mitochondrial DNA (bases 10,470–10,766 in humans) .

  • Protein Properties: 98 amino acids, ~10.7 kDa, multi-pass membrane structure .

  • Gene Overlap: Unique 7-nucleotide overlap with MT-ND4, enabling efficient transcription in mitochondria .

Recombinant Production and Applications

Recombinant MT-ND4L is synthesized via bacterial expression systems (e.g., E. coli) and purified using affinity chromatography. Key production parameters include:

ParameterDetails
Host OrganismE. coli (common), yeast (partial sequences)
TagN-terminal His-tag for purification
Purity>90% (SDS-PAGE)
ApplicationsStructural studies, Complex I assembly research, disease modeling (e.g., Leber’s Hereditary Optic Neuropathy)

Species-Specific Variants:

SpeciesSourceMass (kDa)Use Case
Canis lupusE. coli10.7Research on metabolic disorders
Neomonachus schauinslandiE. coli10.8Comparative evolutionary studies
Gallus gallusE. coli10.7Avian mitochondrial biology

Clinical Relevance and Disease Associations

Mutations in MT-ND4L are linked to:

  • Leber’s Hereditary Optic Neuropathy (LHON): A T→C mutation at position 10,663 causes valine-to-alanine substitution, disrupting Complex I function and ATP production .

  • Metabolic Disorders: Variants associated with obesity, diabetes, and hypertension .

Research Implications: Recombinant MT-ND4L enables mechanistic studies of Complex I dysfunction in these diseases.

Challenges and Future Directions

While recombinant MT-ND4L is invaluable for structural and functional studies, limitations include:

  • Species-Specific Variability: Sequence divergence impacts cross-species extrapolation .

  • Production Complexity: Multi-pass transmembrane domains complicate folding and solubility .

Future research may focus on optimizing expression systems and integrating recombinant MT-ND4L into therapeutic models for mitochondrial diseases.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
Full length protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
Target Protein Sequence
MSMVYINIFLAFIMSLMGLLMYRSHLMSSLLCLEGMMLSLFIMMAVAILNNHLTLASMTP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MT-ND4L in mitochondrial energy metabolism?

MT-ND4L provides instructions for making NADH dehydrogenase 4L protein, which is part of the large enzyme complex known as Complex I. This complex is active in mitochondria and is essential for oxidative phosphorylation. Within mitochondria, Complex I is embedded in the inner mitochondrial membrane and participates in creating an unequal electrical charge through electron transfer processes .

Methodologically, researchers investigating MT-ND4L function should:

  • Employ spectrophotometric assays measuring NADH oxidation rates

  • Conduct membrane potential measurements using fluorescent probes

  • Perform reconstitution studies with purified components

  • Use genetic approaches (knockdown/knockout) to assess functional consequences

How are recombinant MT-ND4L proteins typically produced for research?

Recombinant MT-ND4L proteins can be produced using bacterial expression systems, with E. coli being a common host. Available commercial preparations include His-tagged versions for various species:

Cat.#Product NameSource (Host)SpeciesTagProtein Length
RFL30306RFRecombinant Full Length Rat NADH-Ubiquinone Oxidoreductase Chain 4L ProteinE.coliRatHisFull Length (1-98)
RFL6425MFRecombinant Full Length Mouse NADH-Ubiquinone Oxidoreductase Chain 4L ProteinE.coliMus musculusHisFull Length (1-97)

When working with recombinant MT-ND4L, researchers should consider:

  • Optimizing expression conditions (temperature, induction time, media composition)

  • Implementing specialized membrane protein purification protocols

  • Verifying proper folding through functional assays

  • Validating protein activity through electron transfer measurements

What techniques are most effective for purifying recombinant MT-ND4L?

Purifying MT-ND4L requires specialized approaches due to its hydrophobic nature and membrane association. Effective methodological strategies include:

  • Initial extraction with mild detergents (DDM, LDAO) that maintain protein structure

  • Implementing affinity chromatography (His-tag purification) under conditions optimized for membrane proteins

  • Using size exclusion chromatography to remove aggregates and ensure monodispersity

  • Conducting systematic detergent screening to identify conditions that maintain native-like folding

Success should be monitored through SDS-PAGE, Western blot, and activity assays specific to Complex I function, such as NADH oxidation rates.

What are the key structural features of MT-ND4L important for experimental design?

MT-ND4L is a small, hydrophobic protein embedded in the inner mitochondrial membrane. Its structural features are critical for Complex I assembly and function. When designing experiments, researchers should consider:

  • The protein contains multiple transmembrane domains that must be properly folded

  • Specific residues (such as Val65 in humans) have been implicated in pathological conditions

  • The protein interacts with other Complex I subunits, influencing assembly and stability

  • Species-specific variations may affect experimental outcomes when using recombinant proteins

How do mutations in MT-ND4L contribute to mitochondrial pathologies?

A mutation in the MT-ND4L gene (T10663C or Val65Ala) has been identified in several families with Leber hereditary optic neuropathy. This mutation changes a single protein building block (amino acid), replacing valine with alanine at position 65 in the NADH dehydrogenase 4L protein . While researchers have not fully determined how this mutation leads to vision loss, experimental approaches to investigate include:

  • Site-directed mutagenesis to introduce specific mutations

  • Blue Native PAGE to assess complex assembly

  • High-resolution respirometry to measure oxygen consumption

  • Spectroscopic techniques to examine electron transfer kinetics

What role does MT-ND4L play in recombination events within mitochondrial DNA?

Recent research has revealed interesting findings regarding recombination involving the MT-ND4L gene. Studies in Crassostrea species (oysters) have detected intraspecific recombination within ND1, ND2, and ND4L genes . Specifically:

  • Recombination analysis using RDP4 with multiple detection methods has identified recombination events in these genes

  • For ND4L, recombination was observed in position 157-243 bp, with C. hongkongnsis as the major parent and C. gigas and C. areakensis as the minor and major parent, respectively

  • These findings suggest MT-ND4L may be particularly prone to recombination events

Researchers investigating similar phenomena should employ:

  • Multiple recombination detection methods (RDP, GENECONV, BOOTSCAN, etc.)

  • Manual verification of breakpoints

  • Phylogenetic analysis to confirm recombinant sequences

How does selection pressure influence MT-ND4L evolution across species?

Selection pressure analysis has revealed that MT-ND4L, like many mitochondrial genes, undergoes purifying selection that drives species evolution . Researchers investigating selection pressures should employ:

  • Nonsynonymous (dN) and synonymous (dS) substitution value calculations

  • Single Likelihood Ancestor Counting (SLAC) to estimate positive or negative selection

  • Mixed Model of Evolution (MEME) to decipher episodic diversifying selection

  • Codon usage analysis to understand nucleotide constraints

These approaches can help identify conserved functional domains versus regions under relaxed selection pressure.

What experimental approaches best address protein-protein interactions involving MT-ND4L?

MT-ND4L functions within Complex I through multiple protein-protein interactions. To investigate these interactions, researchers should consider:

  • Co-immunoprecipitation coupled with mass spectrometry

  • Cross-linking followed by mass spectrometry (XL-MS)

  • Blue native PAGE to preserve native complexes

  • Proximity labeling approaches (BioID, APEX) to capture interaction partners

These methods can reveal both stable and transient interactions, providing insight into MT-ND4L's role in Complex I assembly and function.

What are the optimal conditions for analyzing MT-ND4L incorporation into Complex I?

Studying MT-ND4L incorporation into Complex I requires preserving native protein interactions. Methodological approaches include:

  • Blue Native PAGE optimization with careful detergent selection

  • Pulse-chase labeling to track incorporation kinetics

  • Import assays using isolated mitochondria

  • Proximity labeling to identify assembly intermediates

Researchers should establish baseline assembly kinetics before investigating factors that modulate assembly, such as cellular stress or energy demand changes.

How can researchers effectively measure MT-ND4L contribution to electron transfer?

Complex I is responsible for the first step in the electron transport process, transferring electrons from NADH to ubiquinone . To isolate MT-ND4L's specific contribution, researchers should consider:

What techniques best visualize MT-ND4L localization within mitochondria?

Visualizing MT-ND4L presents challenges due to its small size and membrane embedding. Researchers should consider:

  • Developing highly specific antibodies validated against controls

  • Creating fusion proteins that minimally disrupt function

  • Using super-resolution microscopy techniques

  • Employing correlative light and electron microscopy

Quantitative image analysis can then measure colocalization with other Complex I components under various physiological conditions.

What strategies can overcome solubility issues when working with recombinant MT-ND4L?

The hydrophobic nature of MT-ND4L creates solubility challenges. Effective approaches include:

  • Systematic screening of detergent types and concentrations

  • Testing fusion partners (MBP, SUMO) that enhance solubility

  • Exploring nanodiscs or amphipols as alternatives to detergents

  • Implementing optimized buffer conditions through Design of Experiments approaches

Researchers should monitor both protein solubility and functional activity through each optimization step.

How can researchers differentiate direct MT-ND4L effects from secondary consequences?

Distinguishing direct effects of MT-ND4L alterations from downstream adaptations requires careful experimental design. Methodological approaches include:

  • Acute interventions to minimize compensatory adaptations

  • Time-course experiments capturing immediate versus delayed responses

  • Parallel measurement of multiple parameters to establish causative relationships

  • Rescue experiments reintroducing wild-type protein to confirm specificity

Statistical analysis should include multivariate approaches that can identify co-varying parameters following MT-ND4L perturbation.

What statistical approaches best analyze data from MT-ND4L mutation studies?

MT-ND4L mutation studies generate complex datasets requiring sophisticated analysis. Researchers should consider:

  • Mixed-effects models accounting for experimental batch effects

  • Principal component analysis to identify key differentiating variables

  • Machine learning approaches to identify complex patterns

  • Pathway enrichment analysis to contextualize findings

Multiple testing correction methods should be applied, and effect sizes should be reported alongside p-values.

How should contradictory findings about MT-ND4L function be reconciled?

When faced with contradictory findings, researchers should systematically analyze potential sources of variation:

  • Compare experimental conditions (pH, temperature, detergents) across studies

  • Consider expression system differences affecting protein folding

  • Evaluate assay sensitivity and specificity

  • Analyze genetic background effects in different model systems

Meta-analysis approaches can integrate data across studies, while replication studies using multiple methodologies can resolve persistent contradictions.

What bioinformatic tools are most useful for analyzing MT-ND4L conservation and variation?

Bioinformatic analysis of MT-ND4L can reveal evolutionary patterns and functional constraints. Researchers should employ:

  • Multiple sequence alignment tools to identify conserved residues

  • Codon usage analysis to assess nucleotide bias and constraint

  • Molecular modeling based on related structures

  • Prediction algorithms for transmembrane domains and functional motifs

These approaches can provide context for experimental findings and guide hypothesis generation.

What are common pitfalls in recombinant MT-ND4L expression and how can they be addressed?

Recombinant expression of MT-ND4L presents several challenges. Common issues and solutions include:

  • Low expression levels: Optimize codon usage, reduce expression temperature, use specialized host strains

  • Inclusion body formation: Test fusion partners, adjust induction conditions, optimize solubilization protocols

  • Degradation: Add protease inhibitors, optimize purification speed, adjust buffer conditions

  • Loss of activity: Verify proper folding, maintain native-like membrane environment, carefully select detergents

Systematic optimization through Design of Experiments approaches can efficiently identify optimal conditions.

How can researchers validate antibody specificity for MT-ND4L detection?

Detecting MT-ND4L specifically can be challenging. Validation approaches include:

  • Testing antibodies against knockout/knockdown controls

  • Performing epitope mapping to identify unique regions

  • Pre-adsorbing antibodies with recombinant related proteins

  • Using complementary detection methods (mass spectrometry, activity assays)

Specificity should be tested across multiple applications as cross-reactivity can vary between techniques.

What controls are essential when measuring Complex I activity involving MT-ND4L?

Proper controls are critical for reliable Complex I activity measurements. Essential controls include:

  • Positive controls using commercially available Complex I

  • Negative controls using specific inhibitors (e.g., rotenone)

  • Background controls measuring non-specific activity

  • Calibration standards for quantitative measurements

Additionally, researchers should implement internal normalization with multiple reference activities or proteins to account for preparation-dependent variability.

How can episodic diversifying selection in MT-ND4L be accurately identified and interpreted?

Studies have identified episodic diversifying selection in mitochondrial genes, including those encoding Complex I components . To accurately identify such selection patterns:

  • Apply multiple selection detection methods (SLAC, MEME)

  • Use appropriate statistical thresholds (e.g., p < 0.05)

  • Consider phylogenetic relationships when interpreting results

  • Compare results across different evolutionary timescales

Researchers should interpret findings in the context of protein structure and function, considering how selection at specific sites might influence electron transfer efficiency or complex assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.