Recombinant Cat Peripherin-2 (PRPH2)

Shipped with Ice Packs
In Stock

Description

Introduction to Peripherin-2

Peripherin-2 (PRPH2), formerly known as retinal degeneration slow (RDS), is a photoreceptor-specific tetraspanin protein present in the outer segment rims of rod and cone photoreceptors . This protein is critical for the proper development and maintenance of rod and cone outer segments, making it essential for normal vision . The main function of PRPH2 in photoreceptor morphogenesis is to promote membrane curvature, flattening, and fusion - processes required for the rim formation of outer segment discs and lamellae . Recombinant Cat Peripherin-2 provides researchers with a valuable tool for investigating the function of this protein in feline models and comparative studies across species.

Complex Formation

PRPH2 interacts with another photoreceptor-specific tetraspanin called rod outer segment membrane protein 1 (ROM1) . These proteins form various complexes that are essential for proper photoreceptor function:

  • Non-covalently associated homo-tetramers (PRPH2-PRPH2)

  • Hetero-tetramers with ROM1 (PRPH2-ROM1)

  • Covalently linked intermediate complexes

  • Higher-order complexes consisting of several PRPH2 homo-tetramers

Notably, hetero-tetramers containing ROM1 are excluded from these higher-order complexes . The formation of these complexes is required for PRPH2 to promote the development of rim domains essential for outer segment formation .

Production Method

The recombinant Full-Length Cat Peripherin-2 protein is produced using bacterial expression systems. According to product specifications, the protein (P35906, amino acids 1-346) is fused to an N-terminal His tag and expressed in Escherichia coli . This expression system allows for efficient production of the protein for research applications.

Role in Photoreceptor Maintenance

Peripherin-2 plays several critical roles in photoreceptor structure and function:

  • Stabilization of outer segment discs

  • Promotion of membrane curvature at disc rims

  • Facilitation of membrane fusion processes through its carboxy-terminal domain

  • Initiation of rim membrane curvature

  • Maintenance of flattened rim morphology through complex formation

  • Regulation of disc size and alignment

  • Organization of protein microdomains in the rim region

The importance of PRPH2 is evidenced by the fact that its absence results in failure to develop photoreceptor discs and outer segments, leading to visual impairment .

Peripherin-2 in Disease Models

Mutations in PRPH2 have been identified as the cause of various photoreceptor dystrophies, including forms of retinitis pigmentosa and macular dystrophy . Over 90 different disease-causing mutations in PRPH2 have been identified . These mutations can impact the protein's function in different ways:

  • Some mutations affect the protein's ability to form proper complexes with ROM1

  • Others impact its subcellular localization

  • Some mutations result in haploinsufficiency (particularly affecting rods)

  • Other mutations cause toxic dominant-negative effects (particularly affecting cones)

A recent study on the recurrent PRPH2 missense mutation (p.Arg142Trp) demonstrated that this mutation exerts its pathogenicity by reducing the interaction between PRPH2 and ROM1, accompanied by erroneous subcellular localization .

Basic Research Applications

Recombinant Cat Peripherin-2 has several important applications in basic research:

  • Investigation of protein-protein interactions, particularly with ROM1

  • Studies of complex formation and stability

  • Structural analyses of the protein

  • Comparative studies across species

  • Development of antibodies for immunodetection

  • Validation of animal models for retinal degeneration

Therapeutic Development

Due to the role of PRPH2 mutations in various retinal diseases, recombinant PRPH2 proteins are valuable tools in the development of potential therapies:

  • Gene therapy approaches using adeno-associated viruses (AAVs) carrying PRPH2 have shown promise in mouse models

  • Compacted DNA nanoparticles have been successfully used to deliver PRPH2 in preclinical studies

  • Studies have demonstrated that gene transfer can restore both photoreceptor ultrastructure and function in retinal degeneration models

These therapeutic approaches hold significant promise, as demonstrated by a study showing that subretinal injection of recombinant adeno-associated virus encoding a PRPH2 transgene resulted in stable generation of outer segment structures and formation of new stacks of discs containing both peripherin-2 and rhodopsin, with morphology similar to normal outer segments .

Challenges in PRPH2-Based Therapy Development

Despite promising results in preclinical studies, several challenges remain in developing effective PRPH2-based therapies:

  • Complexities in the pathogenic mechanisms for PRPH2-associated macular disease

  • The need for precise dosing of peripherin-2 to combat haploinsufficiency

  • Differences in how mutations affect rods versus cones

  • Variations in disease mechanisms across different mutations

Research indicates that rods appear more sensitive to the total amount of peripherin-2, whereas cones are more sensitive to having properly assembled peripherin-2 complexes . This suggests that rod-dominant PRPH2-associated disease is primarily caused by haploinsufficiency, while cone-dominant disease results from toxic dominant-negative effects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, kindly consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please notify us in advance for an additional charge.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference point for your own preparations.
Shelf Life
The shelf life of our proteins is dependent on several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PRPH2; RDS; Peripherin-2; Retinal degeneration slow protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-346
Protein Length
Full length protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
PRPH2
Target Protein Sequence
MALLKVKFDQKKRVKLAQGLWLMNWLSVLAGIVIFSLGLFLKIELRKRSDVMNNSESHFV PNSLIGMGVLSCVFNSLAGKICYDALDPSKYAKWKPWLKSYLVVCVLFNIVLFLVALCCF LMRGSLESTLAQGLKNGMKYYRDTDTPGRCFMKKTIDLLQIEFKCCGNNGFRDWFEIQWI SNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPNSPRPCIQYQLTNNSAHYSYDHQT EELNLWVRGCRAALLSYYGSLMNSMGAVTLLVWLFEVSITIGLRYLHTALEGVSNPEDLE CESEGWLLEKSVSETWKAFLESLKKLGKSNQVEAEGADAGQAPEAG
Uniprot No.

Target Background

Function
Peripherin-2 (PRPH2) is an essential protein involved in the morphogenesis of photoreceptor outer segment disks in the retina. It may also play a role alongside ROM1 in maintaining the structural integrity of these disks. PRPH2 is crucial for preserving the thickness of the retinal outer nuclear layer and ensures proper development and organization of the photoreceptor inner segment.
Database Links
Protein Families
PRPH2/ROM1 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment. Photoreceptor inner segment.
Tissue Specificity
Retina (photoreceptor). In rim region of ROS (rod outer segment) disks.

Q&A

What is the molecular structure and function of PRPH2?

PRPH2 (peripherin-2) is a photoreceptor-specific tetraspanin protein characterized by four transmembrane segments and a large intradiskal (EC-2) domain between the third and fourth membrane-spanning segments. The EC-2 domain contains one N-linked glycosylation site and seven conserved cysteine residues that participate in intramolecular and intermolecular disulfide bonds crucial for protein folding and subunit assembly .

Functionally, PRPH2 is essential for the formation and maintenance of rod and cone outer segments. It sits in the membrane of rod discs and cone lamellae, where it provides structural support and maintains the curved shape of these photoreceptor structures. The protein is absolutely required for vision, playing a critical role in photoreceptor outer segment disk morphogenesis .

How does PRPH2 interact with other proteins in photoreceptor cells?

PRPH2 associates with itself and with ROM1, a related tetraspanin protein, to form a mixture of homo- and heterotetramers in mammalian photoreceptors. These core tetramers further link together through intermolecular disulfide bonds to form octamers and higher-order oligomers .

In wild-type outer segments, the molar ratios of rhodopsin to peripherin-2 and ROM1 are approximately 18:1 and 42:1, respectively, with the molar ratio between peripherin-2 and ROM1 being approximately 2.3:1 .

What disease phenotypes are associated with PRPH2 mutations?

Mutations in PRPH2 cause a wide spectrum of inherited retinal degenerations with varying phenotypes:

  • Autosomal dominant retinitis pigmentosa (ADRP)

  • Digenic ADRP

  • Pattern dystrophies (including butterfly-shaped pigment dystrophy and adult vitelliform macular dystrophy)

  • Central areolar choroidal dystrophy (CACD)

  • Various forms of late-onset macular degeneration (MD)

The clinical presentation varies significantly, even among individuals with identical mutations. One of the hallmarks of PRPH2-associated disease is its heterogeneity and variability, with disease onset typically occurring in the 30s-50s age range .

What are the optimal conditions for expressing recombinant PRPH2 in mammalian cell systems?

For successful expression of recombinant PRPH2, researchers should consider the following methodological approach:

  • Expression system selection: COS-7 cells have been successfully used for heterologous expression of PRPH2 . For in vivo studies, recombinant adeno-associated virus (rAAV) vectors have proven effective for expressing PRPH2 minigenes in photoreceptors .

  • Construct design: When designing PRPH2 expression constructs, include the three coding exons and relevant intronic regions to study splicing effects. For fluorescent tracking, PRPH2 can be expressed as a green fluorescent fusion protein .

  • Transfection conditions: For transient transfection in mammalian cells, standard lipid-based transfection reagents work effectively. Maintain post-transfection for 24-48 hours to allow proper protein folding and oligomerization .

  • Temperature considerations: Expression at lower temperatures (30-32°C) may improve folding of certain PRPH2 mutants that are prone to misfolding .

When investigating PRPH2 splicing patterns, be aware that three PRPH2 splice isoforms have been detected in rods and cones: correctly spliced, intron 1 retention, and unspliced. Only the correctly spliced isoform results in detectable protein expression .

What purification strategies are most effective for isolating recombinant PRPH2 while maintaining its native structure?

Effective purification of recombinant PRPH2 requires careful consideration of its membrane protein nature and oligomeric state:

  • Membrane protein extraction: Use mild detergents such as 1% Triton X-100 for initial solubilization from membranes . For immunofluorescence applications, a buffer containing 1 mM CaCl₂, 1 mM MgCl₂, 1% BSA, and 0.1% Triton X-100 in PBS has been effectively used for visualization under confocal microscopy .

  • Affinity purification: For tagged recombinant PRPH2, standard affinity chromatography approaches can be employed. Protein A purification has been used successfully for antibody preparations against PRPH2 .

  • Maintaining oligomeric state: To preserve the native tetrameric state during purification, avoid reducing agents and maintain non-reducing conditions. When analyzing oligomeric states, use non-reducing SDS-PAGE conditions at room temperature (10 min incubation) rather than boiling samples .

  • Quality control: Verify the oligomeric state of purified PRPH2 using velocity sedimentation analysis or non-reducing western blots to confirm the presence of appropriate oligomeric species.

For western blot analysis, both reduced and non-reduced samples should be prepared. Reduced samples should be incubated at 90°C for 5 minutes and run on 10%-20% Tris-HCl gels, while non-reduced samples should be incubated at room temperature for 10 minutes and run on 10% Tris-HCl gels .

How can I design assays to evaluate PRPH2 oligomerization and its impact on function?

To evaluate PRPH2 oligomerization and its functional impact, consider the following methodological approaches:

  • Biochemical oligomerization analysis:

    • Non-reducing western blotting to visualize monomers, dimers, and higher-order oligomers

    • Velocity sedimentation analysis for quantifying the distribution of PRPH2 across different oligomeric states

    • Calculate the PRPH2 monomer:dimer ratio by densitometric analysis of non-saturated bands from western blots using image analysis software (e.g., Image Lab or ImageJ)

  • Tetramerization assessment:

    • Transgenic expression of wild-type and mutant PRPH2 as fluorescent fusion proteins allows visualization of targeting to disc membranes by confocal microscopy

    • Mutations that affect tetramerization (e.g., C214S and L185P) will show retention in the rod inner segment, while tetramerization-competent proteins (wild-type and P216L, C150S mutants) will target to disc membranes

  • Functional correlation:

    • Correlate oligomerization states with subcellular localization using immunofluorescence

    • Evaluate the effect of oligomerization defects on disc morphogenesis using transmission electron microscopy

Research has established that tetramerization is required for PRPH2 targeting and incorporation into disc membranes. Mutations that disrupt tetramerization result in protein retention in the photoreceptor inner segment, demonstrating that a checkpoint exists between the inner and outer segments that allows only correctly assembled PRPH2 tetramers to be incorporated into nascent disc membranes .

What in vivo models are most suitable for studying PRPH2 function and disease mechanisms?

Several well-characterized animal models are available for studying PRPH2 function and disease mechanisms:

  • Mouse models:

    • rds/rd2 mouse: The naturally occurring rds mutant mouse (also known as rd2) is the predominant peripherin-2 animal model, representing a null mutation with no PRPH2 protein expression

    • rds+/- mouse: Heterozygous mice exhibit haploinsufficiency that mimics some forms of human PRPH2-associated retinal degeneration

    • Knock-in models: Various point mutations have been introduced, including C150S and R195L , which recapitulate aspects of human disease

    • PRPH2 overexpressor (PRPH2 OE): Transgenic mice expressing ~30% excess PRPH2 over wild-type levels, useful for studying the effects of increased PRPH2 expression

  • Xenopus models:

    • Transgenic Xenopus tadpoles expressing wild-type and disease-linked PRPH2 mutants as green fluorescent fusion proteins in rod photoreceptors have been used to study targeting and disease mechanisms

  • Delivery methods:

    • For introducing PRPH2 constructs into established models, recombinant adeno-associated virus (rAAV) vectors have been successfully used

    • PRPH2 minigenes containing coding exons and relevant intronic regions can be delivered to study splicing effects in vivo

When selecting an appropriate model, consider that rod and cone photoreceptors appear to have different sensitivities to PRPH2 mutations. Evidence suggests that rods are more sensitive to the total amount of peripherin-2, whereas cones are more sensitive to having properly assembled peripherin-2 complexes . This differential sensitivity contributes to the spectrum of rod-dominant versus cone-dominant disease phenotypes.

How do PRPH2 mutations differentially affect splicing and protein expression in rods versus cones?

PRPH2 mutations exhibit distinct effects on splicing and protein expression in rods versus cones, contributing to their different disease phenotypes:

  • Differential splicing patterns:

    • In wild-type photoreceptors, three PRPH2 splice isoforms are detected: correctly spliced, intron 1 retention, and unspliced

    • Compared to rods, cones naturally show lower expression of correctly spliced and higher expression of unspliced PRPH2

    • Only the correctly spliced isoform results in detectable protein expression

  • Mutation-specific effects:

    • Three out of five cone disease-causing PRPH2 mutations profoundly enhance correct splicing of PRPH2, correlating with strong upregulation of mutant PRPH2 protein expression in cones

    • In contrast, four out of six PRPH2 mutants associated with rod disorders result in reduced PRPH2 protein expression through various mechanisms, including aberrant mRNA splicing, protein mislocalization, and protein degradation

  • Mechanistic implications:

    • In cones, upregulation of PRPH2 levels combined with functional defects caused by the mutation appears to be an important mechanism leading to cone degeneration

    • In contrast, rod-specific PRPH2 mutations typically reduce functional protein levels, suggesting different pathological mechanisms

These findings support a hypothesis that rod-dominant PRPH2-associated disease (e.g., ADRP) is caused by haploinsufficiency, whereas cone-dominant disease is caused by toxic dominant-negative mutations . This explains the diverse clinical manifestations of PRPH2 mutations and suggests that therapeutic approaches may need to be tailored differently for rod versus cone diseases.

What is the relationship between PRPH2:rhodopsin ratios and photoreceptor disc structure?

The relationship between PRPH2:rhodopsin ratios and photoreceptor disc structure reveals critical insights into disc morphogenesis:

  • Normal stoichiometry:

    • In wild-type outer segments, the molar ratios of rhodopsin to peripherin-2 and ROM1 are approximately 18:1 and 42:1, respectively

    • The molar ratio between peripherin-2 and ROM1 is approximately 2.3:1

  • Effects of altered ratios:

    • In rds/+ outer segments (PRPH2 deficiency), the rhodopsin to peripherin-2 ratio increases to ~31:1

    • In Rho+/- outer segments (rhodopsin deficiency), the rhodopsin to peripherin-2 ratio decreases to ~9:1

    • These alterations correlate with changes in disc structure

  • Structural consequences:

    • An increase in the relative peripherin-2 content in discs causes an increase in incisure size and complexity

    • In some Rho+/- outer segments, excess peripherin-2 not incorporated into incisures forms tubular structures similar to those observed in other PRPH2-related models

This data, summarized in the table below, suggests that the proper balance between rhodopsin and peripherin-2 is critical for normal disc morphogenesis:

Protein molar ratioWTrds/+Rho+/-
Rhodopsin : peripherin-218.2 ± 0.630.9 ± 6.08.5 ± 1.5
Rhodopsin : ROM142.2 ± 0.629.9 ± 2.021.6 ± 3.7
Peripherin-2 : ROM12.3 ± 0.11.0 ± 0.22.6 ± 0.6
Rhodopsin : (Peripherin-2 + ROM1)12.7 ± 0.415.1 ± 1.86.0 ± 0.8

These findings suggest that incisures form as an adaptive mechanism to accommodate excess peripherin-2 in photoreceptor discs, providing insight into how alterations in protein stoichiometry affect photoreceptor structure and potentially disease progression .

How do PRPH2 mutations affect the retinal pigment epithelium (RPE) and what are the secondary consequences?

PRPH2 mutations primarily affect photoreceptors but can also lead to significant secondary effects on the retinal pigment epithelium (RPE):

  • Structural abnormalities in RPE:

    • PRPH2 disease models exhibit RPE structural abnormalities and cell loss

    • These defects are not uniform across mutations, suggesting mutation-specific effects on RPE health

  • Functional impairments:

    • Impaired clearance of phagocytosed outer segment material is observed in RPE cells adjacent to PRPH2-mutant photoreceptors

    • Increased microglial activation occurs in retinas with PRPH2 mutations, indicating inflammatory responses

  • Pathogenic mechanism:

    • The abnormal outer segment structures caused by different PRPH2 disease mutations lead to varying degrees of RPE stress

    • This differential stress on the RPE likely contributes to the variable clinical phenotypes observed in patients

    • The impaired digestion and clearance of outer segment material leads to cellular stress, hypertrophy, multinucleation, and accumulation of microglia

Research suggests that RPE defects in PRPH2-associated diseases may represent a secondary response to abnormal photoreceptor outer segments rather than a direct effect of PRPH2 mutations on the RPE. This highlights the complex interplay between photoreceptors and RPE in retinal degeneration and suggests that therapeutic approaches may need to address both photoreceptor and RPE dysfunction .

What antibodies and detection methods are optimal for studying PRPH2 in different experimental contexts?

Several validated antibodies and detection methods are available for studying PRPH2 across various experimental approaches:

  • Western blotting:

    • Polyclonal rabbit anti-PRPH2 (18109-1-AP) at dilutions of 1:1000-1:4000 has been validated for human, mouse, and rat samples

    • Rabbit recombinant antibody (85043-2-RR) at dilutions of 1:5000-1:50000 for higher sensitivity applications

    • For detection, secondary antibodies such as donkey anti-rabbit DyLight 800 work well for infrared imaging systems

  • Immunofluorescence:

    • For immunofluorescence on tissue sections (IF-P), use antibody 18109-1-AP at dilutions of 1:200-1:800

    • Include proper detergent (0.1% Triton X-100) for membrane protein accessibility

  • Specialized applications:

    • For sandwich ELISA and cytometric bead array applications, matched antibody pairs are available (e.g., 68780-1-PBS capture and 68780-2-PBS detection)

    • These pairs are provided in PBS only (BSA and azide free) at a concentration of 1 mg/mL, ready for conjugation

  • Sample processing:

    • For reduced samples: incubate with Laemmli sample buffer containing 100 mM DTT at 90°C for 5 min and run on 10%-20% Tris-HCl gels

    • For non-reduced samples (to preserve oligomeric states): incubate with Laemmli buffer without DTT at room temperature for 10 min and run on 10% Tris-HCl gels

For image analysis of western blots, densitometric analysis of non-saturated bands can be performed using software such as Image Lab v4.1 (Bio-Rad) and ImageJ . When detecting oligomeric forms of PRPH2, non-reducing conditions are essential to preserve intermolecular disulfide bonds.

How can I troubleshoot issues with recombinant PRPH2 expression and subcellular localization?

When encountering issues with recombinant PRPH2 expression and localization, consider these troubleshooting approaches:

  • Low expression levels:

    • Verify mRNA expression using qRT-PCR to determine if the issue is at the transcriptional or post-transcriptional level

    • Check for alternative splicing, as only correctly spliced PRPH2 results in detectable protein expression

    • Different mutations can dramatically affect splicing efficiency - some mutations enhance correct splicing in cones while others reduce it

  • Mislocalization:

    • Confirm the tetramerization status of your PRPH2 construct, as tetramerization is required for proper targeting to disc membranes

    • Tetramerization-defective mutants (e.g., C214S and L185P) are retained in the inner segment, while tetramerization-competent proteins (wild-type, P216L, and C150S) target to disc membranes

    • There appears to be a cellular checkpoint between the photoreceptor inner and outer segments that only allows correctly assembled PRPH2 tetramers to be incorporated into nascent disc membranes

  • Protein degradation:

    • Some PRPH2 mutants may be subject to enhanced degradation. Include proteasome inhibitors (e.g., MG132) in your experiments to determine if degradation is a factor

    • Monitor protein stability over time with cycloheximide chase experiments to determine half-life differences between wild-type and mutant proteins

  • Abnormal oligomerization:

    • Loss of ROM1 can result in an ~50% increase in the fraction of PRPH2 that runs in a monomeric state, indicating impaired oligomerization

    • Some PRPH2 mutations may disrupt cysteine residues involved in inter- or intramolecular disulfide bonds, affecting protein folding and assembly

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.