Recombinant Cat Suppressor of Tumorigenicity 7 protein (ST7) is a protein expressed in vitro using an E. coli expression system . ST7, also known as Suppressor of Tumorigenicity 7 protein, is a full-length protein consisting of 585 amino acids . The recombinant form is often used in research . It is tagged with N-terminal 10xHis to facilitate purification and detection .
The amino acid sequence for Recombinant Cat Suppressor of tumorigenicity 7 protein (ST7) is:
MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP
KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSN
NSNSSN
GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQD
HQTFFTCDS
DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLL
PKCAT
AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTN
VLVYIKR
RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQA
VLAKYDD
ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNP
HVPKYL
LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIP
YPLEKG
HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQ
FPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN
Although direct research on recombinant cat ST7 is limited, studies on similar proteins and related molecules provide additional context.
TCTP (Translationally Controlled Tumor Protein): TCTP regulates genotoxic stress and tumorigenicity via intercellular communication . TCTP is an essential component of small extracellular vesicles (sEVs), regulating their secretion, protein, and RNA content, thereby affecting both apoptosis and cancer .
ST7L (Suppression of Tumorigenicity 7 Like): MicroRNA-23b and ST7L have roles in the progression of Hepatocellular carcinoma .
When working with recombinant proteins, it is important to consider several factors to maintain the integrity and activity of the protein .
ST7 has been identified as a tumor suppressor gene located in chromosome region 7q31.1-q31.2. The protein plays a significant role in cancer suppression through regulation of cellular structure maintenance and oncogenic pathway modulation .
Studies using fluorescently tagged ST7 fusion proteins (GFP, YFP, or V5) demonstrated predominantly cytosolic expression in multiple cancer cell lines including HCT-116 (colorectal cancer), MCF-7 (breast cancer), and PC-3 (prostate cancer). Notably, translocation from cytoplasm to nucleus has not been observed under any experimental conditions tested .
Cell cycle synchronization experiments reveal that ST7 expression is significantly upregulated when cells are in arrested states. When cells re-enter division status, ST7 expression levels markedly decrease. This expression pattern suggests ST7 may function as a cell cycle regulator, potentially contributing to its tumor suppressor activity .
Research indicates successful use of a gateway cloning system with various tags (GFP, YFP, or V5) for creating ST7 expression vectors. Full-length ST7 cDNA isolated from human adult brain cDNA library serves as an effective template for these constructions .
While specific synchronization protocols weren't detailed in available studies, cell cycle synchronization has been successfully employed to analyze ST7 expression at different cell cycle stages. This methodology is critical for understanding ST7's variable expression patterns and potential regulatory mechanisms throughout the cell cycle .
Based on established research methodologies, appropriate controls for ST7 studies should include: untransfected cells, vector-only controls, non-targeting siRNA controls (for knockdown studies), and time-matched samples for expression analysis across cell cycle stages .
Research has identified SERPINE1 as demonstrating similar expression patterns to ST7 during cell cycle progression, with both genes showing elevated expression in arrested cells and reduced expression when cells re-enter division. Additionally, Survivin, MMP-13, and Cyclin D1 display differential expression during the cell cycle, suggesting potential functional relationships with ST7 .
Evidence suggests ST7 mediates tumor suppression through regulation of genes involved in maintaining cellular structure and oncogenic pathways. This regulatory function appears to influence cell cycle progression and potentially other cancer-related cellular processes .
While direct comparisons weren't provided in the available literature, ST7's cell cycle-dependent expression pattern (high in arrested cells, low in dividing cells) offers an interesting contrast to other tumor suppressors. This distinctive expression profile suggests specialized regulatory mechanisms that may complement other tumor suppression pathways .
ST7's cell cycle-dependent expression pattern suggests it may represent a potential target for therapies that aim to restore proper cell cycle control in cancer cells. Understanding how ST7 regulates genes like Survivin, MMP-13, and Cyclin D1 could lead to novel approaches for modulating these critical oncogenic pathways .
Recent research on decoy receptors like sFzd7 has demonstrated effectiveness in inhibiting cancer cell growth by blocking signaling pathways (e.g., Wnt pathway). Similar approaches might be explored with ST7, particularly investigating whether ST7-derived constructs could function as decoy proteins to modulate cancer-related signaling pathways .
Given that some decoy receptors (like sFzd7) show anti-tumor activity by inhibiting the Wnt signaling pathway, and that ST7 regulates Cyclin D1 (a Wnt target gene), future research might explore potential interactions between ST7 and Wnt pathway components. This could reveal whether ST7's tumor suppressive function involves direct or indirect modulation of Wnt signaling .
Based on research methodologies, appropriate statistical approaches for ST7 expression analysis would include paired t-tests or ANOVA for comparing expression levels across different cell states or cancer types, with significance typically set at p<0.05. Correlation analyses may be valuable for examining relationships between ST7 and related genes like SERPINE1 .
When conducting ST7 research across different cell lines, researchers should account for variations in baseline expression levels, genetic background differences, and tissue-specific regulatory mechanisms. Cell authentication, passage number standardization, and consistent culture conditions are critical for minimizing experimental variability .
A comprehensive validation strategy should include multiple complementary approaches: gene expression analysis (qRT-PCR), protein expression confirmation (Western blot), subcellular localization studies (immunofluorescence), and functional assays assessing proliferation, apoptosis, migration, and invasion. Both gain-of-function and loss-of-function studies should be conducted to fully characterize ST7's role .
| Cancer Cell Line | Cancer Type | ST7 Expression Pattern | Observed Translocation |
|---|---|---|---|
| HCT-116 | Colorectal | Cytosolic | None detected |
| MCF-7 | Breast | Cytosolic | None detected |
| PC-3 | Prostate | Cytosolic | None detected |
Note: Localization determined via fluorescence signals from ST7 fusion proteins with GFP, YFP, or V5 tags
| Gene | Expression in Arrested Cells | Expression in Dividing Cells | Potential Relationship to ST7 |
|---|---|---|---|
| ST7 | Overexpressed | Diminished | Tumor suppressor activity |
| SERPINE1 | Overexpressed | Diminished | Co-regulated with ST7 |
| Survivin | Differentially expressed | Differentially expressed | Cell cycle regulation |
| MMP-13 | Differentially expressed | Differentially expressed | Tissue remodeling |
| Cyclin D1 | Differentially expressed | Differentially expressed | Cell cycle progression |
Note: Expression patterns observed in cell cycle synchronization studies
| Protein | Primary Function | Cellular Localization | Anti-tumor Mechanism |
|---|---|---|---|
| ST7 | Tumor suppression | Cytosolic | Regulation of cellular structure genes and oncogenic pathways |
| sFzd7 | Decoy receptor | Extracellular | Inhibits Wnt signaling by blocking Wnt-Fzd7 interaction |
| β-catenin | Transcription co-activator | Nucleus/Cytoplasm | Key mediator in Wnt signaling pathway |
| Cyclin D1 | Cell cycle regulator | Nucleus | Controls G1/S phase transition |
Note: Compiled from studies on tumor suppressor mechanisms
Future research should consider CRISPR/Cas9-mediated gene editing to create ST7 knockout models, proteomics analysis to identify ST7 interaction partners, and ChIP-seq to determine if ST7 influences gene expression through direct or indirect DNA interactions. Single-cell analysis might reveal heterogeneity in ST7 function across cell populations .
Investigating ST7 alongside established tumor suppressors could reveal synergistic mechanisms and potential for combination therapies. For example, exploring how ST7 might complement decoy receptor approaches (like soluble Fzd7) could identify novel therapeutic strategies for cancers with aberrant Wnt signaling .