Recombinant Cat Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cat Suppressor of Tumorigenicity 7 Protein (ST7)

Recombinant Cat Suppressor of Tumorigenicity 7 protein (ST7) is a protein expressed in vitro using an E. coli expression system . ST7, also known as Suppressor of Tumorigenicity 7 protein, is a full-length protein consisting of 585 amino acids . The recombinant form is often used in research . It is tagged with N-terminal 10xHis to facilitate purification and detection .

General Information

CategoryDescription
Product CodeCSB-CF022767CA
SynonymsST7; Suppressor of tumorigenicity 7 protein
UniProt IDQ2IBA8 (Chlorocebus Aethiops) , A0M8T1 (Felis catus)
SourceE. coli
SpeciesChlorocebus Aethiops , Felis catus (Cat) (Felis silvestris catus)
TagHis
Protein LengthFull Length (1-585)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles . Store working aliquots at 4°C for up to one week .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ .
Expression Region1-585

Amino Acid Sequence

The amino acid sequence for Recombinant Cat Suppressor of tumorigenicity 7 protein (ST7) is:
MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP
KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSN
NSNSSN
GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQD
HQTFFTCDS
DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLL
PKCAT
AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTN
VLVYIKR
RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQA
VLAKYDD
ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNP
HVPKYL
LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIP
YPLEKG
HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQ
FPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN

Related Research

Although direct research on recombinant cat ST7 is limited, studies on similar proteins and related molecules provide additional context.

  • TCTP (Translationally Controlled Tumor Protein): TCTP regulates genotoxic stress and tumorigenicity via intercellular communication . TCTP is an essential component of small extracellular vesicles (sEVs), regulating their secretion, protein, and RNA content, thereby affecting both apoptosis and cancer .

  • ST7L (Suppression of Tumorigenicity 7 Like): MicroRNA-23b and ST7L have roles in the progression of Hepatocellular carcinoma .

Considerations for Usage

When working with recombinant proteins, it is important to consider several factors to maintain the integrity and activity of the protein .

  • Avoid repeated freezing and thawing .

  • Aliquot the protein upon reconstitution to minimize freeze-thaw cycles .

  • Store at the recommended temperatures to ensure stability .

  • Use sterile techniques to prevent contamination .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
Full length protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
ST7
Target Protein Sequence
MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN
Uniprot No.

Target Background

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Suppressor of Tumorigenicity 7 (ST7) protein and where is it located in the genome?

ST7 has been identified as a tumor suppressor gene located in chromosome region 7q31.1-q31.2. The protein plays a significant role in cancer suppression through regulation of cellular structure maintenance and oncogenic pathway modulation .

What is the subcellular localization pattern of ST7 protein?

Studies using fluorescently tagged ST7 fusion proteins (GFP, YFP, or V5) demonstrated predominantly cytosolic expression in multiple cancer cell lines including HCT-116 (colorectal cancer), MCF-7 (breast cancer), and PC-3 (prostate cancer). Notably, translocation from cytoplasm to nucleus has not been observed under any experimental conditions tested .

How does ST7 expression change throughout the cell cycle?

Cell cycle synchronization experiments reveal that ST7 expression is significantly upregulated when cells are in arrested states. When cells re-enter division status, ST7 expression levels markedly decrease. This expression pattern suggests ST7 may function as a cell cycle regulator, potentially contributing to its tumor suppressor activity .

What expression vectors are effective for studying ST7 in laboratory settings?

Research indicates successful use of a gateway cloning system with various tags (GFP, YFP, or V5) for creating ST7 expression vectors. Full-length ST7 cDNA isolated from human adult brain cDNA library serves as an effective template for these constructions .

What cell synchronization methods are recommended for studying ST7's cell cycle-dependent expression?

While specific synchronization protocols weren't detailed in available studies, cell cycle synchronization has been successfully employed to analyze ST7 expression at different cell cycle stages. This methodology is critical for understanding ST7's variable expression patterns and potential regulatory mechanisms throughout the cell cycle .

What experimental controls should be included when investigating ST7 function?

Based on established research methodologies, appropriate controls for ST7 studies should include: untransfected cells, vector-only controls, non-targeting siRNA controls (for knockdown studies), and time-matched samples for expression analysis across cell cycle stages .

What genes show coordinated expression patterns with ST7 during cell cycle progression?

Research has identified SERPINE1 as demonstrating similar expression patterns to ST7 during cell cycle progression, with both genes showing elevated expression in arrested cells and reduced expression when cells re-enter division. Additionally, Survivin, MMP-13, and Cyclin D1 display differential expression during the cell cycle, suggesting potential functional relationships with ST7 .

How does ST7 mediate tumor suppression at the molecular level?

Evidence suggests ST7 mediates tumor suppression through regulation of genes involved in maintaining cellular structure and oncogenic pathways. This regulatory function appears to influence cell cycle progression and potentially other cancer-related cellular processes .

How might ST7 expression patterns be compared to other tumor suppressors used in cancer research?

While direct comparisons weren't provided in the available literature, ST7's cell cycle-dependent expression pattern (high in arrested cells, low in dividing cells) offers an interesting contrast to other tumor suppressors. This distinctive expression profile suggests specialized regulatory mechanisms that may complement other tumor suppression pathways .

How might research on ST7 inform development of cancer therapeutics targeting cell cycle regulation?

ST7's cell cycle-dependent expression pattern suggests it may represent a potential target for therapies that aim to restore proper cell cycle control in cancer cells. Understanding how ST7 regulates genes like Survivin, MMP-13, and Cyclin D1 could lead to novel approaches for modulating these critical oncogenic pathways .

What are potential approaches for studying ST7's role alongside other decoy receptors in cancer therapy?

Recent research on decoy receptors like sFzd7 has demonstrated effectiveness in inhibiting cancer cell growth by blocking signaling pathways (e.g., Wnt pathway). Similar approaches might be explored with ST7, particularly investigating whether ST7-derived constructs could function as decoy proteins to modulate cancer-related signaling pathways .

How might ST7 research integrate with studies of the Wnt signaling pathway in cancer?

Given that some decoy receptors (like sFzd7) show anti-tumor activity by inhibiting the Wnt signaling pathway, and that ST7 regulates Cyclin D1 (a Wnt target gene), future research might explore potential interactions between ST7 and Wnt pathway components. This could reveal whether ST7's tumor suppressive function involves direct or indirect modulation of Wnt signaling .

What statistical approaches are most appropriate for analyzing ST7 expression data across different cancer types?

Based on research methodologies, appropriate statistical approaches for ST7 expression analysis would include paired t-tests or ANOVA for comparing expression levels across different cell states or cancer types, with significance typically set at p<0.05. Correlation analyses may be valuable for examining relationships between ST7 and related genes like SERPINE1 .

How should researchers address potential confounding factors when studying ST7 in different cancer cell lines?

When conducting ST7 research across different cell lines, researchers should account for variations in baseline expression levels, genetic background differences, and tissue-specific regulatory mechanisms. Cell authentication, passage number standardization, and consistent culture conditions are critical for minimizing experimental variability .

What are recommended approaches for validating ST7's functional effects in cancer models?

A comprehensive validation strategy should include multiple complementary approaches: gene expression analysis (qRT-PCR), protein expression confirmation (Western blot), subcellular localization studies (immunofluorescence), and functional assays assessing proliferation, apoptosis, migration, and invasion. Both gain-of-function and loss-of-function studies should be conducted to fully characterize ST7's role .

Table 1: ST7 Cellular Localization in Cancer Cell Lines

Cancer Cell LineCancer TypeST7 Expression PatternObserved Translocation
HCT-116ColorectalCytosolicNone detected
MCF-7BreastCytosolicNone detected
PC-3ProstateCytosolicNone detected

Note: Localization determined via fluorescence signals from ST7 fusion proteins with GFP, YFP, or V5 tags

Table 2: Gene Expression Patterns During Cell Cycle in Relation to ST7

GeneExpression in Arrested CellsExpression in Dividing CellsPotential Relationship to ST7
ST7OverexpressedDiminishedTumor suppressor activity
SERPINE1OverexpressedDiminishedCo-regulated with ST7
SurvivinDifferentially expressedDifferentially expressedCell cycle regulation
MMP-13Differentially expressedDifferentially expressedTissue remodeling
Cyclin D1Differentially expressedDifferentially expressedCell cycle progression

Note: Expression patterns observed in cell cycle synchronization studies

Table 3: Comparison of Cancer-Related Protein Functions

ProteinPrimary FunctionCellular LocalizationAnti-tumor Mechanism
ST7Tumor suppressionCytosolicRegulation of cellular structure genes and oncogenic pathways
sFzd7Decoy receptorExtracellularInhibits Wnt signaling by blocking Wnt-Fzd7 interaction
β-cateninTranscription co-activatorNucleus/CytoplasmKey mediator in Wnt signaling pathway
Cyclin D1Cell cycle regulatorNucleusControls G1/S phase transition

Note: Compiled from studies on tumor suppressor mechanisms

What novel experimental approaches might advance understanding of ST7's mechanism of action?

Future research should consider CRISPR/Cas9-mediated gene editing to create ST7 knockout models, proteomics analysis to identify ST7 interaction partners, and ChIP-seq to determine if ST7 influences gene expression through direct or indirect DNA interactions. Single-cell analysis might reveal heterogeneity in ST7 function across cell populations .

How might ST7 research integrate with studies of other tumor suppressors to develop combination therapies?

Investigating ST7 alongside established tumor suppressors could reveal synergistic mechanisms and potential for combination therapies. For example, exploring how ST7 might complement decoy receptor approaches (like soluble Fzd7) could identify novel therapeutic strategies for cancers with aberrant Wnt signaling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.