Recombinant Cat Thyrotropin receptor (TSHR)

Shipped with Ice Packs
In Stock

Description

Recombinant TSHR Production and Validation

Recombinant human TSHR (rhTSHR) is produced in systems like HEK293T, CHO, and baculovirus . Key validation metrics include:

Table 1: Functional Assays for Recombinant TSHR

ParameterTSHR-Glo Assay SAFA-TSH (CHO) HEK293T Stable Cells
EC₅₀ (cAMP)15% inter-assay CV6x dose equivalence30.81–36.12 ng/mL
SpecificityNo cross-reactivity with FSH/hCG N/AConfirmed via GFP reporter
Purity>90% (SEC-HPLC) >85% (SDS-PAGE) >90% (flow cytometry)

Graves’ Disease

  • Adenovirus-Induced Model: Immunizing mice with adenovirus expressing human TSHR-ECD induced persistent TSHR antibodies (TBII, TSAb) and hyperthyroidism .

    • Key Outcomes: Elevated free T4 (fT4), thyroid hyperplasia, and dual TBAb/TSAb positivity in 38% of mice .

Hypothyroidism

  • TSHR Knockout (KO) Mice: Exhibited undetectable thyroid hormones, elevated TSH, and absent sodium-iodide symporter (NIS) .

    • Rescue: Forskolin (adenylate cyclase agonist) restored iodide organification in KO thyroids, confirming cAMP’s sufficiency for hormone synthesis .

Long-Acting Recombinant TSH

SAFA-TSH, a modified recombinant human TSH, demonstrated prolonged activity in rats but required 6x higher doses than Thyrogen® for equivalent cAMP production .

Table 2: Pharmacokinetic Comparison of SAFA-TSH vs. Thyrogen

MetricSAFA-TSHThyrogen
Half-life (rats)48 h12 h
T4 Elevation Duration>72 h24 h
Dose for Equivalent cAMP6x higherBaseline

Veterinary Use

Recombinant human TSH (rhTSH) is used in dogs for thyroid reserve testing, though feline applications remain unexplored .

Limitations and Future Directions

  • Species-Specific Gaps: No studies report recombinant feline TSHR production or characterization.

  • Translational Potential: Structural homology between human and feline TSHR (~85% amino acid similarity) suggests cross-species reactivity could be explored.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSHR; Thyrotropin receptor; Thyroid-stimulating hormone receptor; TSH-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-763
Protein Length
Full Length of Mature Protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
Target Protein Sequence
KGCPSPPCECHQEDDFRVTCKDIHRIPSLPPSTQTLKFIETHLKTIPSRAFSNLPNISRI YLSIDATLQRLESHSFYNLSKMTHIEIRNTRSLTYIDPGALKELPLLKFLGIFNTGLGVF PDLTKVYSTDVFFILEITDNPYMTSIPANAFQGLCNETLTLKLYNNGFTSIQGHAFNGTK LDAVYLNKNKYLTAIDQDAFGGVYSGPTLLDVSYTSVTALPSKGLEHLKELIARNTWTLK KLPLTLSFLHLTRADLSYPSHCCAFKNQKKIRGILESFMCNDSSIRSLRQRKSVNALNGP FDQEYEEYLGDSHAGYKDNSKFQDTRSNSHYYVFFEEQDEILGFGQELKNPQEETLQAFD SHYDYTVCGGNEDMVCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLALLGNVFVLIILLTS HYKLTVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYYNHAIDWQTGPGCNAAGFFTV FASELSVYTLTVITLERWYAITFAMRLDRKMRLRHAYAIMVGGWVCCFLLALLPLVGISS YAKVSICLPMDTETPLALAYIILVLLLNIVAFIIVCSCYVKIYITVRNPQYNTGDKDTKI AKRMAVLIFTDFMCMAPISFYALSALMNKPLITVTNSKILLVLFYPLNSCANPFLYAIFT KTFQRDVFILLSKFGICKRQAQAYRGQRVSPKNSTGIQVQKVTRNMRQSLPNMQDDYELL ENSHLTPNKQSHISKEYNQTVL
Uniprot No.

Target Background

Function
The Thyrotropin Receptor (TSHR) serves as the receptor for both thyroid-stimulating hormone (TSH) or thyrotropin, and the heterodimeric glycoprotein hormone (GPHA2:GPHB5) or thyrostimulin. Its activity is mediated by G proteins that activate adenylate cyclase. This receptor plays a crucial role in regulating thyroid cell metabolism.
Database Links
Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of feline TSHR?

The feline thyrotropin receptor (TSHR) is a G protein-coupled receptor primarily expressed in thyroid follicular cells. Structurally similar to other mammalian TSHRs, it consists of a large extracellular domain that binds TSH, seven transmembrane domains, and an intracellular domain that couples to G proteins. The receptor mediates thyroid hormone synthesis and release through multiple signaling pathways. In cats, TSHR activation primarily triggers the Gαs-cAMP/protein kinase A/ERK pathway and the Gαq-Akt/protein kinase C pathway, similar to those observed in other species . These pathways regulate crucial thyroid functions including iodide uptake, thyroglobulin production, and thyroid hormone synthesis. Recent transcriptomic analyses have revealed that feline TSHR shares significant homology with human TSHR, particularly in regions associated with G protein coupling and signal transduction .

How does constitutive activity in feline TSHR affect experimental design?

The feline TSHR, like its counterparts in other species, demonstrates constitutive activity even in the absence of TSH stimulation . When designing experiments to study recombinant cat TSHR, researchers must account for this baseline activity. Methodologically, this requires establishing appropriate controls to distinguish between constitutive activity and ligand-induced activation. In cell-based assays, pretreatment with pathway-specific inhibitors can help quantify the extent of constitutive signaling. For instance, studies in rat thyrocytes have demonstrated that continuing constitutive TSHR activity can be detected in cells deprived of TSH and serum for 48 hours through pathway-specific chemical inhibition . Researchers working with recombinant cat TSHR should consider similar approaches, potentially including measurement of baseline cAMP levels and ERK phosphorylation before stimulus addition.

What experimental approaches can differentiate between TSHR-dependent and TSHR-independent thyroid functions in cats?

To differentiate between TSHR-dependent and TSHR-independent thyroid functions, researchers can adapt methodologies from TSHR knockout studies. Evidence from TSHR knockout mice suggests that while sodium-iodide symporter (NIS) expression requires TSHR signaling, thyroglobulin expression occurs independently of TSHR . For feline studies, this distinction can be explored through:

  • RNA interference techniques to selectively suppress TSHR expression in feline thyrocytes

  • Pharmacological inhibition of TSHR signaling pathways using specific inhibitors

  • Comparative expression analysis of thyroid-specific genes in the presence and absence of TSHR activation

For example, forskolin (an adenylate cyclase agonist) can restore iodide uptake in TSHR-deficient systems, suggesting that downstream cAMP signaling can bypass TSHR requirements for certain functions . When studying recombinant cat TSHR, researchers can use this approach to determine which thyroid functions are directly dependent on TSHR and which may be regulated through alternative mechanisms.

What cell models are most appropriate for studying recombinant cat TSHR?

For functional studies of recombinant cat TSHR, researchers should consider the following cell models:

When selecting a cell model, researchers should consider both the experimental question and methodological constraints. For signaling pathway characterization, FRTL-5 cells provide an established system where pathway activation can be monitored using specific immunoblots and enzyme immunoassays . For studies requiring a feline-specific cellular environment, primary cell cultures from cat thyroid tissue may be necessary despite their technical challenges.

What are the optimal methods for assessing TSHR signaling pathway activation?

Assessment of TSHR signaling pathway activation should include both Gαs and Gαq effector pathways. Based on current research methodologies, the following approaches are recommended:

Signaling PathwayMeasurement MethodKey ParametersTime Point
Gαs/cAMPELISA or RIA for cAMPIntracellular cAMP concentration5-30 minutes post-stimulation
Gαs/ERKWestern blotERK1/2 phosphorylation5-30 minutes post-stimulation
Gαq/PKCWestern blotPKC phosphorylation15-60 minutes post-stimulation
Gαq/AktWestern blotAkt phosphorylation15-60 minutes post-stimulation
Downstream EffectorsRT-PCRGene expression changes6-24 hours post-stimulation

For comprehensive analysis, researchers should measure multiple signaling nodes, as different TSHR-activating ligands (including antibodies) may preferentially activate specific pathways . For instance, some TSHR-blocking and TSHR-neutral antibodies primarily influence Gαq effectors while having minimal effects on Gαs pathways . When studying recombinant cat TSHR, analyzing both immediate (second messenger) and delayed (gene expression) responses provides a more complete understanding of receptor function.

How can researchers validate the specificity of recombinant cat TSHR expression systems?

Validating the specificity of recombinant cat TSHR expression systems requires multiple complementary approaches:

  • Molecular validation:

    • RT-PCR with feline TSHR-specific primers to confirm mRNA expression

    • Western blotting with validated anti-TSHR antibodies

    • Sequencing of the expressed receptor to confirm fidelity

  • Functional validation:

    • Dose-dependent cAMP response to TSH stimulation

    • Blockade of response with specific TSHR antagonists

    • Absence of response to non-cognate ligands

  • Comparative analysis:

    • Parallel testing with human recombinant TSHR as a reference standard

    • Comparison with endogenous TSHR in feline thyroid tissue

For example, in TSHR knockout studies, researchers have employed nested RT-PCR and immunoblotting techniques to confirm the absence of TSHR expression . Similar approaches with appropriate primers and antibodies can validate recombinant cat TSHR expression. Additionally, functional assays such as TSH-stimulated cAMP production or iodide uptake provide critical validation of receptor activity.

How do somatic mutations in TSHR contribute to feline hyperthyroidism?

Recent transcriptomic analysis has revealed that feline hyperthyroidism (FHT) involves somatic mutations in the TSHR signaling pathway. Unlike germline mutations, these somatic alterations were detected in thyroid RNA-seq reads but were absent in paired blood samples from the same cats . The mutations occur in two main components:

  • TSHR mutations: Present in a small subset of hyperthyroid cats, these mutations likely result in constitutive receptor activation.

  • Gsα mutations: More prevalent than TSHR mutations, these were found in all advanced cases of FHT examined. In vitro studies demonstrated that these mutations lead to increased cAMP production, confirming their activating nature .

These findings have significant methodological implications for researchers. When studying feline TSHR in hyperthyroidism, sampling of both thyroid tissue and matched normal tissue (e.g., blood) is essential to distinguish somatic from germline mutations. Additionally, sequencing should target both TSHR and downstream signaling molecules, particularly Gsα, as mutations in either can produce similar phenotypes through constitutive pathway activation .

How can recombinant TSHR be used to optimize radioiodine treatment for feline hyperthyroidism?

Recombinant TSHR research has direct applications in optimizing radioiodine (131I) treatment for feline hyperthyroidism. Although most studies have used recombinant human thyrotropin (rhTSH) rather than feline-specific recombinant TSHR, the principles are applicable to feline-specific research.

Methodologically, pilot studies at Ghent University have investigated using rhTSH to optimize radioiodine treatment of feline hyperthyroidism . The approach involves:

  • Pre-treatment with rhTSH before radioiodine administration

  • Measurement of radioiodine uptake with and without rhTSH stimulation

  • Adjustment of radioiodine dosing based on enhanced uptake

This optimization can potentially allow decreased therapeutic dosage of radioiodine, improving radioprotection while maintaining treatment efficacy . For researchers developing recombinant cat TSHR, similar approaches could be explored with species-specific stimulation, potentially offering even more precise control of radioiodine uptake in feline thyroid tissue.

What transcriptomic approaches best characterize TSHR pathway dysregulation in feline thyroid disease?

RNA-seq based transcriptomic analysis has proven valuable for characterizing TSHR pathway dysregulation in feline hyperthyroidism. The methodological approach includes:

  • Comparison of thyroid tissue from hyperthyroid and euthyroid cats

  • Identification of differentially expressed genes

  • Pathway analysis focusing on TSHR downstream signaling

  • Detection of missense variants in TSHR and related signaling molecules

This approach successfully identified dysregulated pathways in FHT, many of which are downstream of TSHR . For optimal results, researchers should:

  • Include matched controls (euthyroid cats of similar age)

  • Pair RNA-seq with germline DNA sequencing to distinguish somatic from inherited mutations

  • Validate key findings through functional assays (e.g., cAMP production)

  • Consider single-cell RNA-seq to detect cellular heterogeneity within thyroid nodules

When applying these approaches to recombinant cat TSHR research, researchers can use transcriptomic data to identify which signaling pathways to prioritize in functional assays and therapeutic development.

How does feline TSHR compare functionally to human and canine TSHR?

While species-specific differences exist, feline TSHR shares fundamental functional characteristics with human and canine TSHR:

FeatureFeline TSHRHuman TSHRCanine TSHR
G Protein CouplingGαs and GαqGαs and GαqGαs and Gαq
Constitutive ActivityPresentPresentPresent
Role in PathologyHyperthyroidismGraves' disease, toxic nodulesHypothyroidism
Cross-reactivity with rhTSHFunctional responseNative ligandFunctional response

Methodologically, this comparative understanding is important because human recombinant TSH (rhTSH) has been used effectively in veterinary applications for both dogs and cats . The cross-species functionality suggests conservation of key structural elements, particularly in the ligand-binding and G-protein coupling domains. For researchers developing recombinant cat TSHR, these similarities enable the use of established human TSHR methodologies as starting points for feline-specific protocols.

What can TSHR knockout models teach us about feline TSHR research approaches?

TSHR knockout models, though not specifically developed in cats, provide valuable methodological insights for feline TSHR research. Studies in TSHR knockout mice demonstrated:

  • TSHR expression is required for sodium-iodide symporter (NIS) expression but not for thyroglobulin expression .

  • Thyroid hormone synthetic pathways can be dissociated into TSHR-dependent and TSHR-independent steps .

  • The cAMP pathway is crucial for restoring iodide uptake, as demonstrated by the ability of forskolin (an adenylate cyclase agonist) to restore function in TSHR-KO thyroids .

For feline TSHR research, these findings suggest methodologies that can distinguish between direct TSHR-mediated effects and downstream pathway activation. Researchers could:

  • Use cAMP pathway modulators to bypass TSHR in functional studies

  • Examine which thyroid-specific genes are regulated by TSHR versus other factors

  • Develop conditional knockdown approaches in feline cell models to mimic aspects of the knockout phenotype

These approaches would help establish which aspects of thyroid function are directly dependent on TSHR signaling in cats, informing both basic research and therapeutic development.

How applicable are TSHR antibody studies from other species to feline research?

Studies of TSHR antibodies in other species provide important frameworks for feline research, though with notable considerations:

  • Signaling diversity: Different TSHR antibodies can have unique signaling imprints that differ from TSH ligand itself . This principle likely applies across species boundaries.

  • Pathway selectivity: Some TSHR-blocking and TSHR-neutral antibodies can activate specific pathways (primarily Gαq) while having minimal effect on others .

  • Functional consequences: TSHR antibodies can induce cell proliferation even when classified as "blocking" in traditional assays .

For researchers working with recombinant cat TSHR, these findings highlight the importance of comprehensive functional characterization beyond simple agonist/antagonist classification. Methodologically, this requires:

  • Testing antibodies across multiple signaling readouts (cAMP, ERK, Akt)

  • Examining both acute (signaling) and chronic (proliferation, gene expression) responses

  • Considering species-specific epitopes when developing or selecting antibodies

These methodological considerations are particularly relevant for developing diagnostic or therapeutic approaches targeting feline TSHR.

How can understanding Gsα mutations inform therapeutic approaches for feline hyperthyroidism?

Recent findings that all advanced cases of feline hyperthyroidism (FHT) carried at least one missense variant affecting Gsα has significant implications for therapeutic development. The activating nature of these mutations, demonstrated by increased cAMP production in vitro , suggests that targeting constitutive Gsα activity might be more effective than targeting TSHR itself.

Methodologically, researchers exploring this avenue should consider:

  • Developing small molecule inhibitors specific to constitutively active Gsα

  • Testing existing inhibitors of cAMP production or downstream effectors

  • Evaluating the efficacy of these approaches in cell models expressing the identified Gsα mutations

This represents a paradigm shift in therapeutic strategy, focusing on the common downstream pathway rather than the receptor itself. For researchers working with recombinant cat TSHR, incorporating Gsα variants into their expression systems would create more physiologically relevant models of FHT that could be used for drug screening and development.

What methodological approaches can distinguish between the roles of TSHR and Gsα mutations in feline hyperthyroidism?

Distinguishing between the pathogenic contributions of TSHR and Gsα mutations requires sophisticated experimental approaches:

  • Gene editing: Using CRISPR/Cas9 to introduce specific mutations into normal feline thyrocytes

  • Combinatorial analysis: Testing combinations of TSHR and Gsα mutations to identify synergistic effects

  • Temporal studies: Determining whether TSHR or Gsα mutations occur earlier in disease progression

A particularly valuable approach would be the development of inducible expression systems for mutant TSHR and Gsα in feline thyrocytes, allowing temporal control over when each mutation is expressed. This would help determine whether one mutation predisposes cells to acquire the other, informing our understanding of disease progression.

How might species-specific recombinant TSHR improve radioiodine therapy protocols compared to rhTSH?

While recombinant human TSH (rhTSH) has been used successfully to optimize radioiodine treatment in cats , species-specific recombinant cat TSHR or its ligand might offer several advantages:

  • Potentially greater specificity for feline thyroid tissue

  • More predictable dose-response relationships

  • Reduced risk of cross-species immunogenicity

To evaluate these potential benefits, researchers would need to:

  • Compare the efficacy of rhTSH versus recombinant feline TSH in stimulating radioiodine uptake

  • Conduct dose-optimization studies specific to feline thyroid tissue

  • Develop standardized protocols that account for species-specific responses

Such research could advance the "as low as reasonably achievable" (ALARA) principle in veterinary nuclear medicine , potentially reducing radioiodine doses while maintaining therapeutic efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.