Recombinant Cat Type I iodothyronine deiodinase (DIO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DIO1; Type I iodothyronine deiodinase; 5DI; DIOI; Type 1 DI; Type-I 5'-deiodinase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Felis catus (Cat) (Felis silvestris catus)
Target Names
DIO1
Target Protein Sequence
MGLSQLGLWLRRLWVLFQVALQVAVGKVFLILFPSRVKQHIVAMNRKNPHFSYDNWAPTL YSVQYFWFVLKVRWQRLEDRTEPGGLAPNCPVVRLSGQRCSIWDFMKGNRPLVLNFGSCT UPSFLFKFDQFKRLIEDFCSIADFLIIYIEEAHASDGWAFKNNVNIRNHRNLQDRLQAAC LLLDRSPRCPVVVDTMKNQSSRLYAALPERLYVLQAGRILYKGKPGPWNYHPEEVRAVLE KLHS
Uniprot No.

Target Background

Function

Recombinant Cat Type I iodothyronine deiodinase (DIO1) is responsible for the deiodination of thyroxine (T4) to triiodothyronine (T3) and the subsequent deiodination of T3 to 3,3'-diiodothyronine (T2). It plays a crucial role in peripheral T3 production through the deiodination of T4 in tissues such as the liver and kidney.

Database Links
Protein Families
Iodothyronine deiodinase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is cat Type I iodothyronine deiodinase (DIO1) and how does it differ from other mammalian DIO1 enzymes?

Cat Type I iodothyronine deiodinase (DIO1) is a selenoprotein enzyme that catalyzes the conversion of thyroid hormones through deiodination reactions. Like other DIO1 enzymes, it is a membrane-bound protein primarily found in liver, kidney, and thyroid tissues. Cat DIO1 differs significantly from rat and human DIO1 in its substrate selectivity and kinetic properties.

Unlike DIO2 (which catalyzes only outer ring deiodination) and DIO3 (which catalyzes only inner ring deiodination), DIO1 can catalyze both types of reactions, making it functionally versatile . The efficiency of cat DIO1 for deiodination of T4 and T3 remains quite similar to human or rat enzymes, despite its notable difference in rT3 metabolism .

What molecular mechanisms explain the unique substrate selectivity of cat DIO1?

The unique substrate selectivity of cat DIO1 has been elucidated through molecular analyses comparing cat DIO1 with rat and human DIO1 sequences. The molecular basis for these differences is concentrated in the region between amino acid residues 40 and 70, with several key distinctions:

  • Cat DIO1 lacks the amino acid residues present at positions 48-52 (Thr-Gly-Met-Thr-Arg) found in human and rat DIO1 .

  • Additional differences exist in the amino acid residues corresponding to positions 45-46 and 65-66 in the human sequence .

Through comprehensive site-directed mutagenesis studies, researchers have determined that multiple changes are necessary to improve the deiodination of rT3 by cat DIO1 enzyme:

  • The presence of a phenylalanine (Phe) at position 65

  • Insertion of the Thr-Gly-Met-Thr-Arg sequence at positions 48-52

  • The presence of glycine (Gly) and glutamic acid (Glu) at positions 45-46

Importantly, any single modification alone resulted in only limited improvement of rT3 deiodination . This suggests the active site of wild-type cat DIO1 is less flexible than the active site of rat/human DIO1, creating a preferential binding environment for sulfated iodothyronines. The findings indicate great structural flexibility in the DIO1 active site that adapts to various substrates, with species-specific variations in this adaptability .

What expression systems are most effective for producing recombinant cat DIO1?

While the search results don't specifically address cat DIO1 expression systems, the approaches used for other DIO1 proteins provide valuable guidance for researchers working with feline DIO1. Several expression systems have demonstrated success:

  • Yeast expression system (Saccharomyces cerevisiae): This system has been successfully used to express mutant rat DIO1 (with selenocysteine replaced by cysteine), achieving high yields of approximately 65 pmol/mg microsomal protein compared to about 3 pmol/mg in native rat liver microsomes . This represents significant enrichment that could facilitate purification and characterization studies.

  • Insect cell expression: Recombinant DIO proteins have been successfully expressed in Hi5 insect cells, which is particularly valuable for selenoproteins as these cells can incorporate selenocysteine at UGA codons when a selenocysteine insertion sequence (SECIS) element is present . DIO1 expressed in this system showed catalytic activity in radioactive deiodinase assays using 125I-rT3 with DTT as reductant .

  • Bacterial expression: BL21 Codonplus (DE3) bacteria have been used to express DIO proteins with induction conditions of 1 mM MgSO4 overnight at 20°C after induction with 0.5 mM IPTG . This system typically requires optimization for selenoprotein expression.

  • Mammalian cell expression: COS7 cells have been used for stable transfection and expression of DIO1 variants for activity studies .

The choice of expression system depends on research goals. For structural studies requiring high protein yields, the yeast system may be preferred. For functional studies where native selenocysteine is crucial, insect or mammalian cell systems would be more appropriate. Researchers should consider whether they need the native selenocysteine-containing enzyme or if a cysteine mutant is sufficient for their experimental purposes.

How is DIO1 activity typically measured in laboratory settings?

Several methodologies have been developed for measuring DIO1 activity, each with specific advantages for different research questions:

  • Radioactive assays:

    • This represents the traditional gold standard for deiodinase activity measurement .

    • Procedure: Incubation mixtures containing about 100,000 cpm 125I-rT3 with varying concentrations of unlabeled substrate and enzyme preparations in buffer (typically 100 mM phosphate, 2 mM EDTA, 10 mM DTT, pH 7.2) .

    • After incubation (10-60 minutes at 37°C), reactions are stopped by addition of 5% BSA followed by 10% trichloroacetic acid to precipitate proteins .

    • Released radioiodide is separated from remaining iodothyronines by chromatography on Sephadex LH-20 columns .

    • This method offers high sensitivity and is particularly useful for kinetic studies.

  • Non-radioactive Sandell-Kolthoff (SK) assay:

    • This colorimetric method measures iodide release using the Sandell-Kolthoff reaction .

    • The assay utilizes cerium and arsenic compounds, where iodide catalyzes the reduction of Ce4+ (yellow) to Ce3+ (colorless) by As3+ .

    • The SK reaction can be monitored by measuring the decrease in absorbance at 420 nm over time .

    • Advantages include high-throughput capability and avoidance of radioactive materials.

    • The "DIO1-SK assay" has been developed specifically for human liver microsomes, offering a new approach method (NAM) for thyroid hormone disruption studies .

  • Mass spectrometry-based assays:

    • Samples are analyzed for deiodination products (e.g., rT3 formation) using liquid chromatography-mass spectrometry .

    • Reactions are typically stopped with acetic acid, followed by liquid-liquid extraction of thyroid hormone metabolites .

    • This approach allows direct quantification of multiple reaction products simultaneously.

For cat DIO1 specifically, researchers should adjust assay conditions to account for its higher Km for rT3 (11 μM) compared to rat/human DIO1, and consider including sulfated iodothyronines as substrates given cat DIO1's preference for these compounds .

What are the optimal conditions for measuring cat DIO1 activity in vitro?

Based on established protocols for DIO1 enzymes, the following conditions would be optimal for measuring cat DIO1 activity in vitro:

  • Buffer composition:

    • 100 mM phosphate buffer (pH 7.2-8.0)

    • 2 mM EDTA to chelate metal ions that might interfere with the assay

    • 10-20 mM DTT as reducing cofactor

  • Substrate considerations:

    • For cat DIO1, substrate concentrations should account for its higher Km for rT3 (11 μM)

    • Include appropriate concentrations of unlabeled substrate (typically 0.1-10 μM)

    • For radioactive assays, approximately 100,000 cpm 125I-labeled substrate

    • Include sulfated iodothyronines (particularly rT3S) as substrates, given cat DIO1's preference for these compounds

  • Enzyme concentration and incubation time:

    • Protein amount should be adjusted to consume less than 30% of the substrate during the assay

    • Typical incubation times range from 10-60 minutes at 37°C

    • Verify linearity of the reaction throughout the incubation period

  • Reaction termination and product detection:

    • For radioactive assays: add 100 μl 5% BSA followed by 500 μl 10% trichloroacetic acid, then separate free iodide by chromatography

    • For mass spectrometry: stop reactions with 10 μL of 100% acetic acid and process for LC-MS analysis

    • For non-radioactive SK assays: follow established protocols for measuring iodide through cerium-arsenic reaction

  • Controls:

    • Include blank incubations without enzyme to correct for non-enzymatic deiodination (typically <3% of total deiodination)

    • Use well-characterized DIO1 preparations (e.g., rat liver microsomes) as positive controls

    • Include known DIO1 inhibitors (e.g., PTU) to confirm specificity of the measured activity

Careful optimization of these conditions will ensure reliable and reproducible measurement of cat DIO1 activity, accounting for its unique kinetic properties.

How does the substitution of selenocysteine with cysteine affect the catalytic activity of recombinant DIO1?

The substitution of selenocysteine (Sec) with cysteine (Cys) in the catalytic center of DIO1 has significant consequences for enzymatic function. This substitution is often necessary for heterologous expression systems that cannot efficiently incorporate selenocysteine. Key effects include:

These effects align with the proposed catalytic mechanism involving the selenol group (SeH) being converted by reaction with substrate into a selenenyl iodide (SeI) intermediate, which is then regenerated by the reducing cofactor . The thiol group (SH) of cysteine is less nucleophilic than the selenol group of selenocysteine, resulting in reduced catalytic efficiency and altered inhibitor sensitivity.

This knowledge is crucial for researchers designing recombinant DIO1 expression systems, as they must consider the impact of this substitution on activity measurements and inhibitor studies.

What role does the active site structure play in determining the catalytic efficiency of cat DIO1?

The active site structure of DIO1 enzymes, including cat DIO1, is a critical determinant of substrate selectivity and catalytic efficiency. Several key structural elements contribute to the unique properties of cat DIO1:

  • Substrate binding pocket:

    • The region between amino acid residues 40-70 contains concentrated differences between cat and human/rat DIO1 .

    • Specific amino acids in this region create a binding environment that favors sulfated iodothyronines in cat DIO1 .

    • The absence of Thr-Gly-Met-Thr-Arg (positions 48-52) and differences at positions 45-46 and 65 collectively contribute to cat DIO1's higher Km for rT3 .

  • Catalytic selenocysteine and supporting residues:

    • The catalytic selenocysteine forms the core of the active site and directly participates in the deiodination reaction .

    • Evidence suggests that the selenocysteine forms a selenenyl-sulfide with the adjacent cysteine residue (Cys124 in human DIO1), which appears critical for the reaction mechanism .

    • This interaction likely affects the nucleophilicity of the selenocysteine and its ability to attack the carbon-iodine bond.

  • Proton relay network:

    • A proposed hydrogen-bonded proton relay network including Ser123, Thr125, Glu156, and His174 (in human DIO1) appears to transfer protons to the substrate during deiodination .

    • Mutation studies support this model - for example, Thr125 is essential as DIO1 T125A was entirely inactive, while DIO1 T125S retained almost wild-type activity .

    • The hydroxyl function of Ser123 contributes to but is not essential for deiodination, as DIO1 S123A showed reduced but detectable activity .

  • Structural flexibility:

    • The active site of wild-type cat DIO1 appears less flexible than that of rat/human DIO1 .

    • This reduced flexibility likely contributes to its selective preference for sulfated iodothyronines.

    • The finding that multiple mutations are needed to improve rT3 deiodination suggests that the active site structure functions as an integrated unit rather than through independent contributions of individual residues .

Understanding these structural determinants provides insight into the evolution of species-specific differences in DIO1 function and offers targets for rational enzyme engineering.

How can site-directed mutagenesis be used to modify the substrate specificity of cat DIO1?

Site-directed mutagenesis represents a powerful approach for modifying the substrate specificity of cat DIO1, as demonstrated in comprehensive studies that identified key determinants of its unique selectivity. The following strategy has proven effective:

  • Identification of critical regions:

    • Sequence comparison between cat DIO1 and human/rat DIO1 reveals concentrated differences in the region between amino acid residues 40 and 70 .

    • This region includes key differences that affect substrate binding and catalytic efficiency.

  • Strategic mutation design:

    • Key mutations that have been successfully employed include:
      a) Insertion of Thr-Gly-Met-Thr-Arg at positions 48-52 (missing in cat DIO1)
      b) Substitution at positions 45-46 with Gly and Glu (as in human DIO1)
      c) Introduction of Phe at position 65

  • Combinatorial approach:

    • Individual mutations alone produced only limited improvement in rT3 deiodination .

    • The combination of all three modifications (insertion of 48-52, changes at 45-46, and Phe65) was necessary to significantly improve cat DIO1's ability to deiodinate rT3 .

  • Selective enhancement:

    • Remarkably, these mutations did not affect the already efficient outer ring deiodination of sulfated rT3 (rT3S) or inner ring deiodination of sulfated T3 (T3S) .

    • This demonstrates the possibility of selectively enhancing specific catalytic activities while preserving others.

The table below summarizes the impact of key mutations on cat DIO1 substrate specificity:

MutationEffect on rT3 deiodinationEffect on rT3S deiodinationEffect on T3S deiodination
Insertion of TGMTR (48-52) aloneLimited improvementAffectedAffected
Gly-Glu at 45-46 aloneLimited improvementAffectedAffected
Phe at position 65 aloneLimited improvementAffectedAffected
All mutations combinedSignificant improvementPreserved efficiencyPreserved efficiency

This approach demonstrates how targeted mutations can be used to engineer DIO1 enzymes with customized substrate preferences, potentially allowing for the development of species-specific models for thyroid hormone metabolism or selective inhibitors for therapeutic purposes.

What assay methods are available for studying DIO1 inhibitors using recombinant cat DIO1?

Several complementary assay methods can be employed to study inhibitors of recombinant cat DIO1, each offering specific advantages depending on research goals:

  • Radioactive iodide release assays:

    • Traditional gold standard methodology using 125I-labeled substrates (typically rT3) .

    • Procedure: Incubate enzyme with labeled substrate and inhibitor candidates, measure released radioiodide after separation by chromatography .

    • Advantages: High sensitivity, well-established protocol, directly measures catalytic activity.

    • Applications: Determination of IC50 values, kinetic studies to identify inhibition mechanisms (competitive, non-competitive, etc.).

  • Non-radioactive Sandell-Kolthoff (SK) assay:

    • Colorimetric method utilizing the cerium-arsenic reaction catalyzed by released iodide .

    • The DIO1-SK assay has been specifically developed using human liver microsomes .

    • Inhibition is measured by monitoring the decrease in iodide production, reflected in reduced catalysis of Ce4+ reduction .

    • Advantages: Safer than radioactive methods, adaptable to high-throughput screening, environmentally friendly.

    • Applications: Primary screening of large compound libraries, identification of novel inhibitor scaffolds.

  • Mass spectrometry-based inhibition assays:

    • Direct measurement of deiodination product formation in the presence of inhibitors .

    • Reaction products are extracted and analyzed by LC-MS, allowing precise quantification .

    • Advantages: No radioactivity, high specificity, ability to monitor multiple reaction products.

    • Applications: Detailed characterization of inhibitor effects on different deiodination pathways.

  • Structure-based inhibitor design:

    • Using insights from cat DIO1's unique substrate preferences to design species-specific inhibitors.

    • Exploiting the preference for sulfated iodothyronines to develop selective compounds.

    • Testing whether inhibitors effective against human/rat DIO1 show different potencies against cat DIO1.

For studying cat DIO1 specifically, researchers should consider its unique kinetic properties:

  • Higher Km for rT3 (11 μM) compared to human/rat DIO1 (0.2-0.5 μM)

  • Preference for sulfated substrates (Vmax/Km for rT3S = 81 vs. rT3 = 3)

  • Potential differences in inhibitor sensitivity resulting from structural differences in the 40-70 amino acid region

These assays provide powerful tools for identifying compounds that could be developed into treatments for feline hyperthyroidism or used as research tools to understand species-specific aspects of thyroid hormone metabolism.

What are the implications of DIO1 research for understanding and treating feline hyperthyroidism?

Research on cat DIO1 has significant implications for understanding and treating feline hyperthyroidism, a common endocrine disorder in older cats:

  • Mechanistic insights into thyroid hormone metabolism:

    • Cat DIO1's unique substrate preferences (favoring sulfated iodothyronines) may influence how cats process thyroid hormones differently from other species .

    • This could potentially explain species-specific aspects of thyroid disease presentation and response to treatment.

    • Understanding the molecular basis for these differences provides insight into evolutionary adaptations in feline thyroid physiology.

  • Radioiodine (I-131) therapy mechanism:

    • Radioiodine therapy is a common treatment for feline hyperthyroidism .

    • The thyroid gland uses iodine to make thyroid hormone, and in hyperthyroid cats, radioiodine acts as a "smart bomb" targeting and destroying overactive thyroid tissue .

    • DIO1 research helps explain why this therapy is effective: DIO1 is involved in iodine metabolism and thyroid hormone regulation, and disruption of these pathways through targeted radiation can restore normal thyroid function.

  • Development of selective DIO1 inhibitors:

    • The unique characteristics of cat DIO1 could be exploited to develop species-specific inhibitors .

    • Current DIO1 inhibitors like propylthiouracil (PTU) are used clinically for treating hyperthyroidism .

    • Research into cat-specific DIO1 inhibitors could lead to more targeted treatments with fewer side effects.

  • Potential for individualized medicine:

    • Research on DIO1 variants could help explain why some cats respond differently to hyperthyroidism treatments .

    • In mouse models, DIO1 deficiency resulted in elevated T4 and rT3 levels while T3 levels remained unchanged, suggesting complex compensatory mechanisms .

    • Additionally, DIO1-deficient mice treated with T3 developed more severe hyperthyroidism than wild-type mice, indicating DIO1's protective role during thyroid hormone excess .

  • Improved diagnostic approaches:

    • Understanding the role of DIO1 in thyroid hormone metabolism could lead to better diagnostic markers for feline hyperthyroidism.

    • Research into DIO enzymes has revealed their potential as targets for detecting thyroid hormone disruption .

The translational potential of cat DIO1 research extends from basic understanding of feline thyroid physiology to practical applications in treating one of the most common endocrine disorders in domestic cats. By elucidating the molecular mechanisms of thyroid hormone metabolism in cats, researchers can develop more effective and targeted therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.