Recombinant Cation-transporting P-type ATPase B (ctpB)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism

ctpB operates as a Cu+-translocating ATPase with the following steps :

  1. Cytosolic Cu+ Binding: Copper is delivered via chaperones to the N-terminal GMSCAAC motif.

  2. ATP Hydrolysis: ATP binds to the cytoplasmic N-domain, triggering phosphorylation of the DKTGTLT motif.

  3. Conformational Shift: Phosphorylation induces structural changes, translocating Cu+ across the membrane.

  4. Cu+ Release: Copper is expelled extracellularly or into vesicles, followed by dephosphorylation.

Key catalytic residues (Cys382, Cys384, Tyr688, Asn689, Met717, Ser721) enable high-affinity Cu+ coordination . Unlike eukaryotic Cu-ATPases, ctpB lacks regulatory N-terminal metal-binding domains but compensates with transmembrane Cu+-specific sites .

Copper Tolerance and Virulence

  • Cu+ Extrusion: Recombinant ctpB expression in M. smegmatis enhances copper tolerance by effluxing cytotoxic Cu+ .

  • ATPase Activation: ATP hydrolysis is specifically stimulated by Cu+ (not Cu2+), with a Km of 0.8 µM for ATP .

  • Pathogen Survival: In M. tuberculosis, ctpB is hypothesized to mitigate host-derived copper toxicity during infection .

Comparative Analysis

FeaturectpBHuman ATP7B
Metal SpecificityCu+Cu+
Regulatory DomainsAbsentN-terminal metal-binding domains
Pathogenic RoleBacterial copper detoxificationHepatic copper homeostasis

Applications and Implications

  • Drug Target: ctpB is a potential target for antitubercular drugs, as copper homeostasis is vital for M. tuberculosis persistence .

  • Biochemical Tool: Recombinant ctpB aids in studying PIB-ATPase mechanisms, including phosphorylation-dephosphorylation kinetics .

Limitations and Future Directions

  • Unresolved Trafficking: The subcellular localization and regulatory pathways of ctpB in mycobacteria remain unclear .

  • Structural Models: High-resolution cryo-EM structures are needed to elucidate Cu+ translocation steps .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ctpB; BQ2027_MB0106C; Cation-transporting P-type ATPase B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-752
Protein Length
full length protein
Species
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Target Names
ctpB
Target Protein Sequence
MAAPVVGDADLQSVRRIRLDVSGMSCAACASRVETKLNKIPGVRASVNFATRVATIDAVG MAADELCGVVEKAGYHAAPHTETTVLDKRTKDPDGAHARRLLRRLLVAAVLFVPLADLST LFAIVPSARVPGWGYILTALAAPVVTWAAWPFHSVALRNARHRTTSMETLISVGIVAATA WSLSSVFGDQPPREGSGIWRAILNSDSIYLEVAAGVTVFVLAGRYFEARAKSKAGSALRA LAELGAKNVAVLLPDGAELVIPASELKKRQRFVTRPGETIAADGVVVDGSAAIDMSAMTG EAKPVRAYPAASVVGGTVVMDGRLVIEATAVGADTQFAAMVRLVEQAQTQKARAQRLADH IAGVFVPVVFVIAGLAGAAWLVSGAGADRAFSVTLGVLVIACPCALGLATPTAMMVASGR GAQLGIFIKGYRALETIRSIDTVVFDKTGTLTVGQLAVSTVTMAGSGTSERDREEVLGLA AAVESASEHAMAAAIVAASPDPGPVNGFVAVAGCGVSGEVGGHHVEVGKPSWITRTTPCH DAALVSARLDGESRGETVVFVSVDGVVRAALTIADTLKDSAAAAVAALRSRGLRTILLTG DNRAAADAVAAQVGIDSAVADMLPEGKVDVIQRLREEGHTVAMVGDGINDGPALVGADLG LAIGRGTDVALGAADIILVRDDLNTVPQALDLARATMRTIRMNMIWAFGYNVAAIPIAAA GLLNPLIAGAAMAFSSFFVVSNSLRLRNFGAQ
Uniprot No.

Target Background

Protein Families
Cation transport ATPase (P-type) (TC 3.A.3) family, Type IB subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is CtpB and what is its primary function?

CtpB functions as a signaling protease that plays a critical role in cell-cell communication pathways, particularly in the SpoIV sporulation pathway. It collaborates with other proteases to regulate intercellular signaling processes essential for bacterial differentiation and development . While some research indicates CtpB may be involved in specific ATPase activities, its primary characterized role involves proteolytic functions in cellular signaling cascades.

How does CtpB differ from other PDZ-proteases?

CtpB belongs to the PDZ-protease family that acts as sensor proteins in diverse biological processes. What distinguishes CtpB is its ability to assemble a "gated protease tunnel" that regulates cell-cell communication . This unique structural arrangement allows CtpB to function in regulated intramembrane proteolysis (RIP) cascades with broader impact on intercellular signaling than many other proteases in this class.

What biological processes involve CtpB activity?

Current research indicates CtpB plays a significant role in sporulation pathways, particularly through its collaboration with protease 4B in the SpoIV pathway . These pathways are critical for bacterial differentiation and survival mechanisms. The involvement of CtpB in these processes demonstrates its importance in cellular development and adaptation responses to environmental conditions.

What is known about the molecular mechanism of CtpB's protease activity?

Despite the importance of PDZ-proteases like CtpB in diverse biological processes, researchers note "it is striking how little is known about the molecular mechanism of C-terminal processing proteases implicated in cellular signaling" . The current understanding suggests CtpB's mechanism involves substrate recognition through its PDZ domain followed by proteolytic processing that triggers downstream signaling cascades, but detailed structural studies are still emerging.

How does the "gated protease tunnel" structure of CtpB function in regulation?

CtpB assembles a gated protease tunnel structure that regulates cell-cell communication . This specialized structural arrangement likely controls substrate access to the proteolytic active site, creating a regulated mechanism for signal transduction. The "gated" nature suggests conformational changes that can open or close access to the catalytic site based on specific cellular conditions or signals.

What is the relationship between CtpB's protease activity and potential ATPase functions?

While CtpB has been primarily characterized as a protease, some research suggests potential ATPase activity may be involved in its regulatory functions. This relationship remains an area of active investigation, with researchers examining whether ATP hydrolysis might power conformational changes in the protein or regulate its proteolytic activity. Methods similar to those used to characterize other ATPases, such as the BIOMOL Green method for measuring phosphate release, could be applicable .

What are the recommended methods for measuring CtpB activity in laboratory settings?

For measuring protease activity of CtpB, researchers typically employ substrate cleavage assays using fluorogenic peptides containing specific recognition sequences. When investigating potential ATPase activity, methods similar to those described for P2RX2 could be adapted, utilizing the BIOMOL Green method to measure released phosphate following ATP hydrolysis . Combined approaches that monitor both activities simultaneously may provide insight into their potential relationship.

A standard protocol might include:

  • Purification of recombinant CtpB protein

  • Incubation with ATP (typically 1 mM) in appropriate buffer conditions

  • Measurement of phosphate release using colorimetric methods

  • Parallel assessment of proteolytic activity using labeled substrates

How should researchers approach site-directed mutagenesis studies of CtpB?

When designing site-directed mutagenesis experiments for CtpB, researchers should focus on:

  • Conserved residues in the PDZ domain that may be involved in substrate recognition

  • Catalytic residues in the protease domain

  • Regions potentially involved in gating the protease tunnel

  • Residues that might coordinate cation binding if investigating ATPase activity

Mutations similar to those studied in other ATPases (such as the K81A mutation in P2RX2) might be informative if examining potential ATPase functions . Functional assays should measure both proteolytic activity and potential effects on ATP hydrolysis to comprehensively characterize the mutants.

What expression systems are most suitable for producing recombinant CtpB?

For optimal expression of functional recombinant CtpB, bacterial expression systems like E. coli can be used with specific considerations for membrane-associated proteins. The expression system should include appropriate tags for purification while ensuring these don't interfere with protein function. For functional studies, expression in HEK293 cells has proven effective for similar proteins with both protease and ATPase activities .

Key considerations include:

  • Use of specialized E. coli strains designed for membrane protein expression

  • Inclusion of solubilizing domains or fusion partners

  • Careful optimization of induction conditions

  • Verification of proper folding and activity post-purification

How should researchers interpret contradictory results in CtpB activity assays?

When facing contradictory results in CtpB research, consider:

  • Buffer composition effects - ionic conditions significantly impact both protease and ATPase activities

  • Protein preparation differences - membrane-associated proteins are sensitive to purification methods

  • Substrate specificity - CtpB may have different activities toward various substrates

  • Regulatory factors - activity may depend on specific cofactors or binding partners

The approach used with P2RX2 research provides a model: when contradictory results emerged, researchers validated findings using multiple methods including both in vitro biochemical assays and live cell experiments to confirm ATPase activity .

What statistical approaches are recommended for analyzing CtpB kinetic data?

For analyzing CtpB kinetic data, researchers should employ:

  • Michaelis-Menten kinetics analysis to determine Km and Vmax values

  • First-order reaction kinetics to establish linearity with reaction time

  • One-way ANOVA with post-hoc tests for comparing activity across different conditions

These approaches have proven effective in similar research contexts, as demonstrated in the P2RX2 ATPase characterization studies where researchers calculated a Km value of 0.62 mM for ATP, indicating high ATP affinity .

How can researchers distinguish between direct and indirect effects when studying CtpB inhibitors?

To distinguish direct inhibition of CtpB from indirect effects:

  • Use purified recombinant protein in in vitro assays with potential inhibitors

  • Employ dose-dependent inhibition studies to establish IC50 values

  • Verify specificity using structurally related but functionally distinct proteins as controls

  • Confirm direct binding through techniques like isothermal titration calorimetry or surface plasmon resonance

An effective approach demonstrated in similar research utilized competitive antagonists specific to the target protein to confirm the specificity of observed activities .

What are common technical challenges in CtpB research and how can they be addressed?

Common challenges in CtpB research include:

ChallengeSolution Approach
Low protein yieldOptimize expression conditions; use specialized vectors for membrane proteins
Protein instabilityInclude appropriate stabilizers; maintain native membrane environment
Activity loss during purificationDevelop gentle purification protocols; verify activity at each step
Inconsistent resultsStandardize protocols; control environmental variables rigorously
Distinguishing multiple activitiesDesign experiments with specific inhibitors and controls for each activity

How can researchers overcome difficulties in crystallizing CtpB for structural studies?

Crystallization of membrane proteins like CtpB presents significant challenges. Researchers should consider:

  • Using lipidic cubic phase (LCP) crystallization techniques specifically designed for membrane proteins

  • Screening multiple detergents and lipid compositions to find optimal stability conditions

  • Creating fusion constructs with crystallization chaperones like T4 lysozyme

  • Removing flexible regions that might hinder crystal packing while preserving functional domains

  • Employing nanobodies or antibody fragments to stabilize specific conformations

What approaches help resolve reproducibility issues in CtpB functional assays?

To improve reproducibility in CtpB research:

  • Standardize protein preparation methods, including consistent purification protocols

  • Perform experiments in triplicate across multiple protein preparations

  • Use internal controls and standard curves in each experiment

  • Document detailed methods including buffer compositions, incubation times, and temperatures

  • Validate findings using complementary techniques, such as both in vitro assays and cellular experiments

Research on P2RX2 demonstrates this approach, where experiments were "performed three different times in triplicate" to ensure statistical significance and reproducibility .

How might high-throughput screening approaches be adapted for CtpB inhibitor discovery?

Developing high-throughput screening methods for CtpB inhibitors could involve:

  • Fluorescence-based activity assays in 384-well plate format

  • Development of cell-based reporter systems that monitor downstream effects of CtpB activity

  • Virtual screening approaches if structural data becomes available

  • Fragment-based drug discovery methods to identify chemical scaffolds with inhibitory potential

The specificity validation approach used for P2RX2 inhibitors like RB-4, which "exhibits no activity against other P2RX receptors," provides a model for confirming hit compound selectivity .

What role might CtpB play in bacterial stress response pathways beyond sporulation?

While current research focuses on CtpB's role in sporulation , its function as a signaling protease suggests potential involvement in broader stress response pathways. Future research directions might explore:

  • Involvement in nutrient limitation responses

  • Potential roles in antibiotic resistance mechanisms

  • Contributions to biofilm formation and maintenance

  • Participation in host-pathogen interactions during infection

How might systems biology approaches enhance our understanding of CtpB's regulatory networks?

Systems biology approaches could reveal the broader context of CtpB function by:

  • Mapping protein interaction networks through proteomics approaches

  • Analyzing transcriptional changes in response to CtpB activity modulation

  • Developing computational models of signaling pathways incorporating CtpB

  • Integrating multiple -omics datasets to identify regulatory relationships

These approaches would help position CtpB within the cellular signaling architecture and identify potential new functions and regulatory relationships beyond those currently characterized.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.