Recombinant Catostomus commersonii [Arg8]-vasotocin receptor

What is the Recombinant Catostomus commersonii [Arg8]-Vasotocin Receptor?

The recombinant Catostomus commersonii [Arg8]-vasotocin receptor is a laboratory-produced version of the native vasotocin receptor found in the white sucker fish (Catostomus commersonii). This G-protein coupled receptor (GPCR) binds to arginine vasotocin (AVT), the non-mammalian homolog of arginine vasopressin (AVP). The recombinant form is typically expressed in systems such as E. coli and includes a His-tag to facilitate purification and identification. The full-length protein consists of 434 amino acids with a molecular structure containing seven transmembrane domains characteristic of GPCRs . This receptor plays important roles in physiological processes and social behavior regulation in fish, making it valuable for comparative studies across vertebrate species .

What is the Amino Acid Sequence of the Catostomus commersonii [Arg8]-Vasotocin Receptor?

The amino acid sequence of the Catostomus commersonii [Arg8]-vasotocin receptor begins with MGRIANQTTASNDTDPFGRNEEVAKMEITVLSVTFFVAVIGNLSVLLAMHNTKKKSSRMHLFIKHLSLADMVVAFFQVLPQLCWEITFRFYGPDFLCRIVKHLQVLGMFASTYMMVMMTLDRYIAICHPLKTLQQPTQRA . This represents the N-terminal portion of the receptor, which is significant as studies have shown that the N-terminus contributes to the affinity of the receptor for its ligand . The complete receptor consists of 434 amino acids forming the characteristic seven-transmembrane structure of G-protein coupled receptors, with extracellular loops that are critical for ligand binding and selectivity .

How Does the [Arg8]-Vasotocin Receptor Function in Signal Transduction?

The [Arg8]-vasotocin receptor functions primarily through two key signaling pathways: inhibition of cAMP production and stimulation of intracellular calcium mobilization. When activated by AVT or related agonists, the receptor couples to G-proteins that inhibit adenylyl cyclase, resulting in decreased cAMP levels. Studies in fish hepatocytes have shown that AVT can inhibit glucagon-stimulated cAMP accumulation by up to 90% . Concurrently, receptor activation triggers increases in intracellular calcium concentration, likely through phospholipase C activation and subsequent IP3-mediated calcium release from intracellular stores .

The receptor exhibits dose-dependent responses, with half-maximal inhibition of cAMP occurring at approximately 2.1×10⁻⁸ M AVT in some fish models . Functionally, the [Arg8]-vasotocin receptor appears most similar to the mammalian V1a-type vasopressin receptor, as evidenced by its response profile to specific agonists and antagonists .

What Molecular Determinants Define the Binding Specificity of the [Arg8]-Vasotocin Receptor?

The binding specificity of the [Arg8]-vasotocin receptor is determined by several key structural elements:

• The N-terminal extracellular domain contributes significantly to ligand affinity but less to selectivity between related nonapeptides .

• The second extracellular loop and its flanking transmembrane segments contain amino acid residues that are conserved throughout the nonapeptide receptor family and contribute to ligand affinity .

• Transmembrane region VI and the third extracellular loop are particularly critical for nonapeptide selectivity, determining which specific ligands (e.g., vasotocin versus isotocin) bind with highest affinity .

• Amino acid residues of transmembrane regions II-VII located close to the extracellular surface also contribute to the binding of vasotocin, as demonstrated through molecular modeling studies .

These structural features allow the receptor to discriminate between related nonapeptides and determine the specificity of the physiological response.

How Does the [Arg8]-Vasotocin Receptor Compare to Mammalian Vasopressin Receptors?

The [Arg8]-vasotocin receptor shares significant structural and functional similarities with mammalian vasopressin receptors, particularly the V1a subtype. Both are G-protein coupled receptors with seven transmembrane domains and exhibit similar signal transduction mechanisms. Pharmacological studies using mammalian receptor agonists and antagonists have shown that the fish vasotocin receptor responds to V1a agonists (such as [Phe², Orn⁸]-oxytocin) but shows limited response to V2 agonists (such as [deamino¹, Val⁴, D-Arg⁸]-vasopressin) .

Similarly, the inhibitory effect of AVT on cAMP production can be reversed by V1 antagonists ([d(CH₂)₅¹, O-Me-Tyr², Arg⁸]-vasopressin), while V2 antagonists ([d(CH₂)₅¹, D-Ile², Ile⁴, Arg⁸, Ala⁹]-vasopressin) have minimal effect . These pharmacological profiles suggest that the ancestral vasotocin receptor in fish likely gave rise to the diversified vasopressin receptor subtypes seen in mammals through evolutionary processes.

What Methodological Approaches Are Most Effective for Studying [Arg8]-Vasotocin Receptor Binding Properties?

For investigating the binding properties of the [Arg8]-vasotocin receptor, researchers have successfully employed several complementary methodological approaches:

• Chimeric Receptor Constructs: Creating chimeric constructs that combine portions of the vasotocin receptor with related receptors (e.g., isotocin receptor) has proven valuable for identifying specific domains involved in ligand binding. These constructs are typically generated through site-directed mutagenesis and molecular cloning techniques .

• Radioligand Binding Assays: Using radiolabeled ligands such as [(3,5-³H)Tyr², Arg⁸]vasotocin to measure binding affinities in membrane preparations from cells expressing the receptor or receptor constructs. This approach allows for quantitative determination of binding constants (Kd) and receptor density (Bmax) .

• Heterologous Expression Systems: Expression of receptor constructs in systems such as human embryonic kidney cells for binding studies and Xenopus laevis oocytes for functional studies has proven effective. These systems allow for controlled expression of wild-type and mutant receptors in isolation from other potentially confounding receptors .

• Second Messenger Assays: Measuring changes in intracellular cAMP levels (using radioimmunoassay or ELISA-based methods) and calcium mobilization (using fluorescent probes like FURA-2/AM) in response to receptor activation provides functional readouts of receptor activity and ligand efficacy .

• Molecular Modeling: Computational approaches that align the vasotocin receptor sequence with those of other G-protein coupled receptors and bacteriorhodopsin have helped identify critical amino acid residues involved in ligand binding, particularly in the transmembrane regions .

The combination of these approaches provides a comprehensive understanding of both the structural determinants of receptor-ligand interactions and the functional consequences of these interactions.

How Do Mutations in Transmembrane Regions Affect Ligand Binding and Receptor Function?

Mutational analysis of the [Arg8]-vasotocin receptor has revealed that specific transmembrane regions play differential roles in ligand binding affinity versus selectivity. Research using chimeric receptor constructs has demonstrated that:

• Transmembrane regions II-VII, particularly amino acid residues located close to the extracellular surface, contribute significantly to vasotocin binding . Mutations in these regions can alter binding affinity without necessarily affecting selectivity between different nonapeptides.

• Transmembrane region VI and the third extracellular loop are especially critical for nonapeptide selectivity . Mutations in this region can dramatically alter the receptor's preference for vasotocin versus related peptides like isotocin.

• The second extracellular loop and its flanking transmembrane segments contain highly conserved amino acid residues that are essential for maintaining proper receptor conformation and ligand binding capability .

The functional consequences of these mutations are typically assessed through measurements of ligand binding affinity (using radioligand binding assays) and downstream signaling responses (using second messenger assays) in expression systems such as human embryonic kidney cells or Xenopus oocytes . This experimental approach allows researchers to correlate specific structural changes with alterations in receptor function, providing insights into the molecular mechanisms of receptor activation and signaling.

What Are the Comparative Second Messenger Responses to [Arg8]-Vasotocin Receptor Activation Across Different Experimental Models?

The second messenger responses to [Arg8]-vasotocin receptor activation show interesting variations across different experimental models, providing insights into receptor coupling and signaling diversity. The following table summarizes comparative data from studies in different systems:

This comparative analysis reveals that while the [Arg8]-vasotocin receptor consistently couples to calcium mobilization pathways across models, its effect on cAMP signaling can vary in magnitude. The potency of AVT and related agonists also shows model-dependent variations, with EC₅₀ values ranging from nanomolar to micromolar concentrations. These differences may reflect variations in receptor density, G-protein coupling efficiency, or the presence of different regulatory proteins across cell types .

What Experimental Challenges Exist in Expressing Functional [Arg8]-Vasotocin Receptors in Heterologous Systems?

Expressing functional [Arg8]-vasotocin receptors in heterologous systems presents several technical challenges that researchers should consider:

Addressing these challenges requires careful experimental design, appropriate controls, and validation of results across multiple experimental approaches.

How Do the Binding Domains of [Arg8]-Vasotocin Receptor Compare with Those of Related Nonapeptide Receptors?

Comparative analysis of the binding domains of the [Arg8]-vasotocin receptor with related nonapeptide receptors reveals both conserved and divergent structural elements that determine ligand specificity and affinity:

• Conserved Elements: The second extracellular loop and its flanking transmembrane segments contain amino acid residues that are highly conserved throughout the nonapeptide receptor family, suggesting a common structural framework for ligand recognition .

• Divergent Elements: Transmembrane region VI and the third extracellular loop show greater sequence variation across nonapeptide receptors and are critical determinants of ligand selectivity . These regions likely underwent evolutionary divergence to accommodate different nonapeptide ligands.

• N-terminal Domain: The N-terminus contributes to receptor affinity for ligands but appears less important for discriminating between different nonapeptides . The length and composition of this domain vary considerably across receptor subtypes.

• Transmembrane Regions II-VII: Amino acid residues in these regions that are located close to the extracellular surface contribute to ligand binding across the receptor family, but specific residues may interact differently with various nonapeptides .

Molecular modeling studies that align sequences of different nonapeptide receptors have helped identify these critical domains. The structural insights gained from studying the [Arg8]-vasotocin receptor have broader implications for understanding the evolution and function of the entire nonapeptide receptor family, including mammalian vasopressin and oxytocin receptors .

What Pharmacological Tools Are Available for Investigating [Arg8]-Vasotocin Receptor Function?

Several pharmacological tools have been validated for investigating [Arg8]-vasotocin receptor function, including both agonists and antagonists with varying degrees of selectivity:

Agonists:

• Arginine Vasotocin (AVT) - The endogenous ligand, showing high potency (EC₅₀ ≈ 2.1×10⁻⁸ M for cAMP inhibition) .

• Isotocin (IT) - Another endogenous fish nonapeptide, showing slightly higher potency than AVT in some systems (EC₅₀ ≈ 0.7×10⁻⁸ M) .

• [Phe², Orn⁸]-oxytocin - A mammalian V1a receptor agonist that also shows activity at fish vasotocin receptors .

• [deamino¹, Val⁴, D-Arg⁸]-vasopressin - A mammalian V2 receptor agonist with limited activity at fish vasotocin receptors .

Antagonists:

• [d(CH₂)₅¹, O-Me-Tyr², Arg⁸]-vasopressin - A mammalian V1 antagonist that effectively blocks AVT-induced responses (IC₅₀ ≈ 1.2×10⁻⁶ M) .

• [d(CH₂)₅¹, D-Ile², Ile⁴, Arg⁸, Ala⁹]-vasopressin - A mammalian V2 antagonist with minimal effect on AVT-induced responses .

Radioligands:

• [(3,5-³H)Tyr², Arg⁸]vasotocin - Useful for binding assays to determine receptor density and affinity constants .

The relative potency of these compounds varies somewhat across experimental systems, but the general rank order of potency for agonists is typically: AVT ≈ IT > V1 agonist > V2 agonist . These tools allow researchers to pharmacologically characterize the receptor and distinguish it from related nonapeptide receptors. They are particularly valuable for determining the receptor subtype involved in specific physiological responses in native tissues where multiple receptor types may be present.

What Are the Key Considerations for Experimental Design When Studying [Arg8]-Vasotocin Receptor-Mediated Responses?

When designing experiments to study [Arg8]-vasotocin receptor-mediated responses, researchers should consider several critical factors:

• Species and Tissue Specificity: The expression pattern and coupling preferences of vasotocin receptors can vary across species and tissue types. For example, in amphibians and reptiles, AVT cells occur in multiple brain regions including the bed nucleus of the stria terminalis, preoptic area, and various pallial and subpallial limbic areas . These distribution patterns should inform tissue selection for ex vivo studies.

• Appropriate Control Conditions: When studying second messenger responses, appropriate positive and negative controls are essential. For cAMP studies, a well-characterized stimulant like glucagon (5×10⁻⁸ M has been used in trout hepatocytes) provides a reliable baseline for measuring inhibitory effects .

• Concentration-Response Relationships: Full concentration-response curves should be established to accurately determine potency (EC₅₀) and efficacy (maximal effect) parameters. For AVT, concentrations typically ranging from 10⁻¹⁰ to 10⁻⁶ M are appropriate for most systems .

• Multiple Readouts of Receptor Activation: Measuring both cAMP inhibition and calcium mobilization provides a more complete picture of receptor function than either parameter alone. For calcium measurements, fluorescent probes like FURA-2/AM have proven effective .

• Pharmacological Validation: Using selective agonists and antagonists helps confirm the specific receptor subtype mediating observed responses. V1-type versus V2-type compounds can help distinguish between different potential receptor subtypes .

• Consideration of Downstream Effectors: Beyond immediate second messengers, consideration of downstream physiological effects provides context for receptor function. For example, in green treefrogs, AVT increases calling behavior even while stimulating corticosterone release, suggesting complex integration of receptor-mediated effects .

By addressing these considerations, researchers can design robust experiments that yield reliable and physiologically relevant insights into [Arg8]-vasotocin receptor function across diverse biological contexts.