Recombinant Catostomus commersonii Isotocin receptor

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Genetic Encoding

The isotocin receptor in C. commersoni belongs to the G-protein-coupled receptor (GPCR) superfamily, characterized by seven transmembrane domains and intracellular signaling via cAMP or calcium pathways . Key structural features include:

  • Gene Organization: Two isotocin precursor genes (isotocin 1 and isotocin 2) encode distinct neurophysin-related proteins with C-terminal leucine-rich segments, resembling mammalian copeptin .

  • Receptor Cloning: The isotocin receptor was cloned using PCR-based methods, revealing intron-free coding sequences and mRNA variants of 920–1,020 bases . Recombinant receptors are typically expressed in heterologous systems like COS-7 cells or Xenopus oocytes for functional studies .

Pharmacological and Functional Properties

Recombinant isotocin receptors exhibit distinct ligand specificity and signaling pathways:

Table 1: Pharmacological Profile of Recombinant Isotocin Receptors

PropertyDetailsSource
Ligand SpecificityBinds isotocin (IT) but not arginine vasotocin (AVT)
Signaling PathwayCoupled to phospholipase C (PLC), increasing intracellular Ca²⁺
Antagonist SensitivityBlocked by V1a and oxytocin receptor antagonists (e.g., SR49059)
EC₅₀ for IsotocinNot explicitly reported for C. commersoni; AVT EC₅₀: ~13 nM in AVTR

Functional assays in Xenopus oocytes showed that isotocin receptors induce chloride currents upon activation, confirming PLC/IP3 pathway coupling .

Tissue Distribution and Physiological Roles

Immunohistochemical and mRNA analyses reveal broad receptor expression:

  • Tissues: Brain, pituitary, kidney, gills, and intestine .

  • Pituitary Function: In C. commersoni, isotocin receptors modulate growth hormone (GH) release but not prolactin (Prl) . For example, isotocin inhibits GH secretion via cAMP and PKC pathways in ricefield eels (Monopterus albus), a model for teleost hormone regulation .

Evolutionary and Comparative Insights

The C. commersoni isotocin receptor shares ancestral traits with vasopressin/oxytocin receptors:

  • Phylogeny: Diverged early from vasotocin receptors, with gene duplication events observed in Actinopterygii (ray-finned fish) .

  • Functional Conservation: Retains prolactin-releasing peptide motifs in neurophysin regions, analogous to mammalian copeptin .

Research Applications

Recombinant isotocin receptors are pivotal for:

  1. Drug Discovery: Screening isotocin agonists/antagonists for aquaculture or endocrine research .

  2. Mechanistic Studies: Elucidating osmotic stress responses and social behavior in fish .

Key Challenges and Future Directions

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. If you have a specific format preference, kindly indicate it in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
All protein orders are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, it is recommended to briefly centrifuge the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Isotocin receptor; ITR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Catostomus commersonii (White sucker) (Cyprinus commersonnii)
Target Protein Sequence
MEEMFKEQDFWSFNESSRNSTVGNETFGGNQTVNPLKRNEEVAKVEVTVLALVLFLALAG NLCVLIAIYTAKHTQSRMYYLMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDFLCRLVK YLQTVGMFASTYMLVLMSIDRCIAICQPLRSLHKRKDRCYVIVSWALSLVFSVPQVYIFS LREIGNGVYDCWGDFVQPWGAKAYITWISLTIYIIPVAILGGCYGLISFKIWQNFKRKTK KDQCITLTTAASKANALARVSSVKLVSKAKITTVKMTFVIVLAYIVCWTPFFFVQMWSAW DPEAPREAMPFIISMLLASLNSCCNPWIYMFFAGHLFHDLKQSLLCCSTLYLKSSQCRCD QEHDSRKSNCSTYVIKSTSSQRSITQSSIT
Uniprot No.

Target Background

Function
This receptor binds to isotocin. It can also be activated by vasotocin, mesotocin, oxytocin, and Arg-vasopressin, although these have lower potencies than isotocin. The receptor induces membrane chloride currents, indicating its coupling to the inositol phosphate/calcium pathway.
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain, intestine, bladder, skeletal muscle, lateral line, gills and kidney.

Q&A

What is the relationship between isotocin receptor and other nonapeptide receptors in Catostomus commersonii?

The isotocin receptor (ITR) in Catostomus commersonii belongs to the nonapeptide receptor family alongside the [Arg8]vasotocin receptor (VTR). These receptors are G-protein coupled receptors that bind teleost-specific nonapeptide hormones. The white sucker fish expresses both receptor types, which show differential binding selectivity—while the VTR discriminates effectively between isotocin (IT) and vasotocin (VT), the ITR shows much less selectivity between these ligands . This binding profile is functionally important as it creates different signaling possibilities in response to the same hormones. Both receptors share conserved structural features in their transmembrane domains and extracellular loops that are characteristic of the nonapeptide receptor subfamily .

How does the structure of the isotocin receptor differ from mammalian oxytocin receptors?

The isotocin receptor from Catostomus commersonii represents an evolutionary precursor to mammalian oxytocin receptors. While both share the canonical seven-transmembrane domain structure common to G-protein coupled receptors, several structural differences exist. The extracellular domains and binding pockets show variations that reflect their different ligand specificities. Unlike mammalian oxytocin receptors, the fish isotocin receptor exhibits broader ligand recognition, binding both isotocin and vasotocin with relatively similar affinities . The transmembrane regions contain highly conserved amino acid residues that are present across nonapeptide receptors, particularly in regions close to the extracellular surface, which are likely involved in forming the peptide binding pocket . Additionally, the N-terminus and the region spanning the second extracellular loop and its flanking transmembrane segments contain conserved residues that contribute to ligand binding affinity.

What is known about the isotocin precursor proteins in Catostomus commersonii?

Catostomus commersonii possesses two distinct isotocin genes (isotocin 1 and isotocin 2) that encode separate precursor proteins . Both genes lack introns in their protein-coding sequences and are transcribed into mRNAs of 920 bases (isotocin 1) and 1020 bases (isotocin 2), respectively . The predicted isotocin precursors contain not only the hormone moiety but also a neurophysin-like protein that, unlike its mammalian counterpart, is extended at its C-terminus by a peptide with a leucine-rich core segment . This extension shows striking similarities to the copeptin present in mammalian vasopressin precursors, though it lacks the consensus sequence for N-glycosylation . The presence of this extension suggests that mammalian copeptin may have evolved from the C-terminus of an ancestral neurophysin molecule .

What expression systems are most effective for producing functional recombinant Catostomus commersonii isotocin receptor?

For functional expression of the Catostomus commersonii isotocin receptor, several expression systems have been utilized with varying degrees of success. While E. coli has been employed for expressing the related [Arg8]-vasotocin receptor , membrane proteins like the isotocin receptor typically require eukaryotic expression systems for proper folding and post-translational modifications.

Based on research with similar receptors, the following expression systems can be considered:

Expression SystemAdvantagesLimitationsApplication
Xenopus laevis oocytesEfficient for functional studies, supports proper membrane insertionLimited protein yield, challenging for purificationElectrophysiological and binding studies
Mammalian cell lines (HEK293, CHO)Proper folding and post-translational modificationsHigher cost, lower yield than microbial systemsBinding assays, signaling studies
Insect cells (Sf9, Hi5)Higher yield than mammalian cells, proper foldingMore complex than bacterial systemsStructural studies, purification
E. coliHigh yield, cost-effectiveLimited post-translational modificationsExpression of fragments, binding domains

For functional studies examining receptor pharmacology and signal transduction, Xenopus oocytes and mammalian cell lines have proven particularly effective, as demonstrated with the related vasotocin receptor .

What strategies can optimize the expression of properly folded isotocin receptor?

Optimizing the expression of properly folded isotocin receptor requires addressing several challenges inherent to membrane protein expression. Based on studies with related nonapeptide receptors, researchers should consider:

  • Codon optimization: Adapting the codon usage to match the expression host can significantly improve translation efficiency. For eukaryotic expression systems, analyzing codon bias and GC content optimization can enhance mRNA stability and translation.

  • Fusion tags: The strategic placement of affinity tags can facilitate both expression and purification. N-terminal tags (such as His-tag) have been successfully employed with the related vasotocin receptor , but their impact on function should be carefully assessed. For the isotocin receptor, placing the tag at a position that doesn't interfere with ligand binding or G-protein coupling is critical.

  • Chaperone co-expression: Co-expressing molecular chaperones can enhance proper folding, particularly in bacterial systems. For eukaryotic systems, modifying culture conditions (temperature reduction, chemical chaperones) can improve folding efficiency.

  • Membrane-mimetic environments: During purification and reconstitution, incorporating appropriate detergents or lipids that mimic the native membrane environment is essential for maintaining receptor stability and functionality.

  • Signal sequence modifications: Optimizing the native signal sequence or replacing it with a well-characterized one from the expression host can improve membrane targeting and insertion.

Each optimization strategy should be empirically tested, as membrane protein behavior can be unpredictable across different expression systems.

What binding assay protocols are most reliable for characterizing isotocin receptor pharmacology?

For reliable characterization of isotocin receptor pharmacology, several binding assay protocols can be employed, each with specific advantages for different research questions:

  • Radioligand binding assays: Utilizing tritiated ([3H]) isotocin or related analogs provides high sensitivity for affinity determination. For the Catostomus commersonii isotocin receptor, methods similar to those employed for the vasotocin receptor can be adapted, using [(3,5-3H)Tyr2] labeled ligands . These assays typically involve incubating membrane preparations from transfected cells with increasing concentrations of labeled ligand, with or without competing unlabeled ligands.

  • Competitive binding assays: These are particularly useful for comparing the receptor's affinity for isotocin versus vasotocin, which is a key pharmacological characteristic of the isotocin receptor's relatively low selectivity compared to the vasotocin receptor .

  • Functional coupling assays: Since isotocin receptors couple to G-proteins, measuring downstream signaling events provides functional readouts. These include:

    • cAMP accumulation assays (for Gs-coupled responses)

    • IP3/calcium mobilization assays (for Gq-coupled responses)

    • β-arrestin recruitment assays (for receptor internalization)

  • Surface expression quantification: Combining binding studies with quantification of surface-expressed receptors (using cell-impermeable biotinylation techniques) allows calculation of binding parameters normalized to receptor density.

When designing these assays, it's important to consider that the isotocin receptor shows less selectivity between isotocin and vasotocin compared to the highly selective vasotocin receptor , which can influence interpretation of competitive binding data.

How can researchers effectively study the signaling pathways activated by the recombinant isotocin receptor?

Studying signaling pathways activated by the recombinant isotocin receptor requires a multi-faceted approach:

  • G-protein coupling specificity determination: Using selective G-protein inhibitors (pertussis toxin for Gi/o, YM-254890 for Gq/11) or BRET/FRET-based sensors to directly measure G-protein activation helps identify which G-protein subtypes couple to the isotocin receptor.

  • Second messenger assays: Measuring changes in second messengers provides functional readouts:

    • cAMP levels (using ELISA, radioimmunoassay, or FRET-based sensors)

    • IP3 production and calcium mobilization (using calcium-sensitive dyes or genetically encoded calcium indicators)

    • ERK1/2 phosphorylation (Western blotting or ELISA-based detection)

  • Receptor internalization and trafficking: Fluorescently tagged receptors allow visualization of trafficking in response to agonist stimulation. This can be particularly informative when comparing responses to isotocin versus vasotocin.

  • Biased signaling analysis: Comparing the activation of different pathways in response to isotocin versus vasotocin can reveal biased signaling properties, which may have physiological significance given the receptor's ability to respond to both ligands.

  • Heterologous expression in appropriate cell contexts: Expressing the receptor in cell types that endogenously express relevant signaling machinery ensures physiologically relevant responses can be measured.

Recent studies with the related vasotocin receptor have shown that investigation of aquaporin trafficking can be an effective downstream readout for receptor activation , suggesting similar approaches might be valuable for the isotocin receptor.

What molecular determinants govern ligand selectivity in the isotocin receptor compared to the vasotocin receptor?

The differential ligand selectivity between isotocin and vasotocin receptors in Catostomus commersonii provides a valuable model for understanding molecular recognition in nonapeptide receptors. Mutational analysis and chimeric receptor studies with the vasotocin receptor have identified several key regions that likely contribute to ligand selectivity in both receptors :

  • N-terminal domain: This region contributes significantly to ligand binding affinity. In chimeric constructs where portions of the vasotocin receptor were replaced with corresponding isotocin receptor segments, changes in the N-terminus affected binding profiles .

  • Second extracellular loop (ECL2) and flanking transmembrane segments: This region contains amino acid residues conserved throughout the nonapeptide receptor family and contributes to receptor affinity for its ligand . The ECL2 likely forms part of the binding pocket and influences the receptor's ability to discriminate between isotocin and vasotocin.

  • Transmembrane domains: Particularly TMs III, IV, and VI contain residues that form the binding pocket and determine selectivity. Key conserved residues in these regions that are present in both receptors but absent in other G-protein coupled receptors likely play crucial roles in nonapeptide recognition .

  • Conserved cysteine residues: These form disulfide bridges that maintain the three-dimensional structure of the binding pocket and are essential for receptor function.

The isotocin receptor's lower selectivity between isotocin and vasotocin (compared to the highly selective vasotocin receptor) suggests differences in the spatial arrangement or flexibility of these binding determinants. Molecular modeling approaches similar to those used for the vasotocin receptor can help visualize these structural differences.

How can site-directed mutagenesis be effectively applied to study isotocin receptor function?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in the isotocin receptor. Based on successful strategies with the related vasotocin receptor, an effective mutagenesis strategy should:

  • Target conserved residues: Focus on amino acids that are conserved across nonapeptide receptors but not in other G-protein coupled receptor families, as these likely play specific roles in isotocin recognition . Particular attention should be paid to:

    • Conserved residues in the extracellular loops and upper portions of transmembrane domains

    • Residues that differ between isotocin and vasotocin receptors, which may account for their different selectivity profiles

  • Create receptor chimeras: Exchanging domains between isotocin and vasotocin receptors can identify regions responsible for specific functional properties, as demonstrated in previous studies . This approach is particularly valuable for understanding the molecular basis for the isotocin receptor's lower ligand selectivity.

  • Employ alanine scanning mutagenesis: Systematically replacing residues in potential binding regions with alanine can identify those critical for ligand recognition versus those involved in receptor activation.

  • Introduce conservative versus non-conservative substitutions: Conservative substitutions (maintaining similar physicochemical properties) can distinguish between structural versus functional roles of specific residues.

  • Combine mutagenesis with computational modeling: Homology modeling based on available structures of related receptors, coupled with docking simulations of isotocin and vasotocin, can guide mutagenesis strategies and help interpret experimental results .

Functional analysis of mutants should employ multiple readouts, including ligand binding assays, G-protein coupling efficiency, and downstream signaling, to comprehensively characterize the impact of mutations.

How can the recombinant isotocin receptor be used to study evolutionary aspects of nonapeptide signaling?

The recombinant Catostomus commersonii isotocin receptor serves as an excellent model for investigating the evolutionary trajectory of nonapeptide signaling systems. Several research approaches can leverage this receptor:

  • Comparative binding studies: Systematically comparing binding properties of isotocin receptors from different fish species can reveal evolutionary patterns in ligand selectivity. The white sucker isotocin receptor's relatively low selectivity between isotocin and vasotocin, contrasted with the high selectivity of its vasotocin receptor , represents an interesting evolutionary intermediate that can be compared with receptors from other species.

  • Ancestral sequence reconstruction: Using phylogenetic analysis to infer ancestral receptor sequences, followed by recombinant expression and functional characterization, can illuminate the evolutionary history of nonapeptide receptors. The isotocin receptor's unique features, like the extended neurophysin-like portion in its precursor protein , provide insights into ancestral states.

  • Domain swapping between evolutionary distant receptors: Creating chimeras between fish isotocin receptors and mammalian oxytocin receptors can identify conserved functional domains and species-specific adaptations.

  • Precursor-receptor co-evolution analysis: Investigating how changes in the isotocin precursor (which in Catostomus commersonii has two distinct forms ) correlate with receptor evolution provides insights into the co-evolution of ligand-receptor pairs.

  • Functional comparison across species: Examining how isotocin receptor signaling properties vary across species with different reproductive and social behaviors can reveal how molecular evolution supports behavioral adaptation.

This research is particularly valuable because the extended C-terminal segment in the fish isotocin precursor shows similarities to the copeptin of mammalian vasopressin precursors , suggesting ancient evolutionary relationships that can be further elucidated through recombinant receptor studies.

What methodologies can be used to study the interaction between isotocin receptor and G-proteins?

Investigating the interaction between the isotocin receptor and G-proteins requires specialized methodologies that can capture these transient and complex protein-protein interactions:

  • Bioluminescence/Förster Resonance Energy Transfer (BRET/FRET): These techniques can detect real-time interactions between the receptor and G-proteins in living cells. By tagging the receptor with a donor fluorophore/luminophore and the G-protein with an acceptor fluorophore, energy transfer occurs upon interaction, providing a quantifiable readout.

  • G-protein subtype-selective uncoupling: Using toxins (pertussis toxin for Gi/o), inhibitors (YM-254890 for Gq/11), or dominant-negative G-protein constructs can determine which G-protein subtypes couple functionally to the isotocin receptor.

  • Immunoprecipitation and proximity labeling approaches: Techniques such as co-immunoprecipitation or proximity-based biotinylation (BioID, APEX) can identify proteins that associate with the receptor, including G-proteins and other signaling components.

  • Electrophysiological recordings in Xenopus oocytes: Co-expression of the isotocin receptor with specific ion channels modulated by G-protein signaling provides functional readouts of G-protein coupling, similar to approaches used with the vasotocin receptor .

  • Molecular dynamics simulations: Computational approaches can model the interaction interface between the receptor and G-proteins, generating hypotheses that can be tested experimentally through site-directed mutagenesis.

  • Structural biology approaches: While challenging, techniques such as cryo-electron microscopy could potentially capture the isotocin receptor-G-protein complex, providing structural insights into the coupling mechanism.

When designing these experiments, it's important to consider that the isotocin receptor may couple to multiple G-protein subtypes, potentially in a ligand-specific manner, given its ability to respond to both isotocin and vasotocin .

What are common challenges in expressing functional isotocin receptor and how can they be overcome?

Expressing functional G-protein coupled receptors like the isotocin receptor presents several challenges that researchers commonly encounter. Based on experience with related receptors, including the vasotocin receptor, these challenges and their solutions include:

  • Low expression levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solutions: Optimize codon usage for the expression host; use strong, inducible promoters; lower expression temperature (28-30°C) to improve folding; utilize specialized expression hosts designed for membrane proteins.

  • Receptor misfolding:

    • Challenge: Complex membrane topology leads to misfolding and aggregation.

    • Solutions: Co-express molecular chaperones; add chemical chaperones to culture media (glycerol, DMSO at low concentrations); optimize disulfide bond formation conditions if expressing in bacteria.

  • Surface trafficking defects:

    • Challenge: Expressed receptor fails to reach plasma membrane.

    • Solutions: Add trafficking-enhancing sequences; use cell lines with robust trafficking machinery; include protease inhibitors during culture to prevent degradation; utilize pufferfish Takifugu rubripes or zebrafish sequences which sometimes traffic better in mammalian cells than sequences from other fish species.

  • Post-translational modification issues:

    • Challenge: Improper glycosylation affecting function or stability.

    • Solutions: Ensure expression system provides appropriate modification machinery; consider site-directed mutagenesis to remove non-essential glycosylation sites that might be problematic in heterologous systems.

  • Constitutive activity or receptor desensitization:

    • Challenge: High expression leads to ligand-independent activity or rapid desensitization.

    • Solutions: Use inducible expression systems; titrate expression levels; co-express relevant phosphatases or arrestin mutants to modulate desensitization.

  • Ligand stability:

    • Challenge: Isotocin degradation during binding assays.

    • Solutions: Include protease inhibitors in binding buffers; perform assays at lower temperatures; use stable isotocin analogs.

Successful expression strategies for the related vasotocin receptor in systems like HEK293 cells and Xenopus oocytes provide templates that can be adapted for the isotocin receptor with appropriate modifications.

How can researchers validate that recombinant isotocin receptor maintains native-like properties?

Validating that a recombinant isotocin receptor retains native-like properties is crucial for ensuring research relevance. A comprehensive validation approach should include:

  • Pharmacological profile comparison:

    • Compare binding affinities of isotocin and vasotocin to recombinant versus native receptors (where possible)

    • Verify that the recombinant receptor maintains the relatively low selectivity between isotocin and vasotocin that characterizes the native receptor

    • Test a panel of agonists and antagonists to create a comprehensive pharmacological fingerprint

  • Signaling pathway verification:

    • Confirm activation of expected G-protein subtypes and downstream effectors

    • Verify coupling to appropriate second messenger systems

    • Compare signaling kinetics with available data on native receptors

  • Post-translational modification assessment:

    • Analyze glycosylation status using enzymatic deglycosylation and/or mass spectrometry

    • Verify phosphorylation patterns in response to agonist stimulation

  • Structural integrity confirmation:

    • Use circular dichroism or other spectroscopic techniques to assess secondary structure

    • Verify correct disulfide bond formation, which is critical for nonapeptide receptor function

    • Employ limited proteolysis to assess proper folding

  • Functional comparison with other species:

    • Compare properties with well-characterized isotocin receptors from related fish species

    • Assess whether species-specific differences are preserved in the recombinant system

  • Desensitization and internalization kinetics:

    • Verify that the receptor undergoes appropriate agonist-induced desensitization

    • Confirm internalization pathways match expected patterns for this receptor family

When isotocin receptor behavior in native tissues cannot be directly assessed, comparison with closely related nonapeptide receptors and cross-species validation can provide confidence in the recombinant system's biological relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.