Recombinant Caulobacter crescentus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
atpF; CC_0365; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Caulobacter crescentus (strain ATCC 19089 / CB15)
Target Names
atpF
Target Protein Sequence
MEHQSLFSFSNPEFWVLAALVIFFGLLVVLKVLPGALFGALDGYAAKIKAELDEAQQLRE EAQALLADVKAQREDAERQAAAMLEAAKADAKRLAEEAKEKLEEQIKRRAEMAERKIAQA EAQAAADVKAAAVDLAAQAAETVLAARLAGAKGDTLVDAAIGQMGAKLQ
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 and F0.

Database Links

KEGG: ccr:CC_0365

STRING: 190650.CC_0365

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of Caulobacter crescentus ATP synthase?

Caulobacter crescentus ATP synthase belongs to the F-type ATP synthase family, which produces ATP from ADP and inorganic phosphate using energy from a transmembrane proton motive force . Like other bacterial ATP synthases, it consists of two major complexes: the membrane-embedded F₀ sector (containing subunits a, b, and c) and the catalytic F₁ sector (containing subunits α, β, γ, δ, and ε). The b subunit (atpF) forms part of the peripheral stalk that connects F₀ and F₁, playing a crucial role in maintaining structural integrity during rotational catalysis .

As observed in other bacterial systems, the ATP synthase likely contains three catalytic β subunits that adopt different conformational states during the catalytic cycle, described as 'open', 'closed', and 'open' . This conformational cycling drives ATP synthesis when protons flow through the membrane-embedded F₀ sector, causing rotation of the central stalk (γ subunit) within the F₁ sector's αβ hexamer.

How does C. crescentus ATP synthase differ from other bacterial ATP synthases?

While sharing the core architecture of bacterial F-type ATP synthases, C. crescentus ATP synthase likely exhibits specialized features related to the organism's distinctive asymmetric life cycle and developmental program. C. crescentus has a complex protein quality control (PQC) network that interfaces with cell cycle and developmental processes, which may influence ATP synthase regulation .

Unlike some other bacterial systems, C. crescentus must coordinate energy production with its dimorphic lifestyle, transitioning between a motile swarmer cell and a sessile stalked cell. This likely requires specific regulatory mechanisms for ATP synthase function during these transitions. The specialized physiology of C. crescentus influences how it manages proteotoxic stress , which may affect ATP synthase stability and activity under different growth conditions.

What is the significance of the b subunit (atpF) in C. crescentus ATP synthase?

The b subunit (atpF) in C. crescentus ATP synthase, like in other bacterial systems, likely serves as a critical component of the peripheral stalk that connects the F₁ and F₀ sectors. Based on structural studies of other bacterial ATP synthases, we can infer that the C-terminal water-soluble part of subunit b displays significant conformational variability between rotational states .

The b subunit's flexibility is crucial for maintaining structural integrity during the catalytic cycle while accommodating the conformational changes that occur during rotational catalysis. In bacterial systems like the thermophilic Bacillus PS3, the peripheral stalk (which includes the b subunit) is structurally simpler and more flexible than in eukaryotic counterparts , suggesting that C. crescentus likely follows a similar pattern of relative structural simplicity.

What are the optimal expression systems for producing recombinant C. crescentus ATP synthase subunit b?

For heterologous expression of C. crescentus ATP synthase subunit b (atpF), several expression systems can be considered:

Expression SystemAdvantagesChallengesRecommended Tags
E. coli BL21(DE3)High yield, well-established protocolsPotential folding issues with membrane proteinsHis₆, Strep-tag II
E. coli C41/C43(DE3)Specialized for membrane proteinsLower yield than standard BL21His₈, MBP fusion
Native C. crescentusProper folding and processingLower yield, more complex manipulationFLAG tag, His₁₀

The choice of expression system should be guided by experimental needs. For structural studies requiring large amounts of protein, E. coli-based systems with codon optimization for C. crescentus genes are recommended. For functional studies where proper folding and assembly are critical, native expression in C. crescentus with careful temperature control (25-30°C) may be preferable.

When expressing membrane proteins like atpF, induction conditions should be optimized to prevent aggregate formation. Low IPTG concentrations (0.1-0.5 mM) and reduced temperatures (16-25°C) during induction typically improve soluble protein yield.

What purification strategies are most effective for recombinant C. crescentus atpF?

Based on approaches used for other bacterial ATP synthase components, a multi-step purification strategy is recommended:

  • Membrane solubilization: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their critical micelle concentration.

  • Affinity chromatography: If expressing with histidine tags, use Ni-NTA resin with imidazole gradients for elution (50-300 mM).

  • Size exclusion chromatography: A final polishing step using Superdex 200 columns helps remove aggregates and ensures homogeneity.

For studying the b subunit in complex with other ATP synthase components, consider:

  • Co-expression strategies with compatible subunits

  • Gentle solubilization conditions to maintain subunit interactions

  • Blue native PAGE to verify complex integrity

Detergent screening is critical, as the optimal detergent may differ from those used for other bacterial ATP synthase preparations. A systematic comparison of detergents (DDM, LMNG, CHAPS) at different concentrations should be performed to optimize yield and activity.

How can researchers verify the proper folding and activity of recombinant atpF?

Verifying proper folding and activity of recombinant atpF involves multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Limited proteolysis to assess compact folding

    • Thermal shift assays to determine protein stability

  • Functional characterization:

    • Binding assays with partner subunits (particularly α and β)

    • Reconstitution experiments with other ATP synthase components

    • ATP hydrolysis assays in reconstituted systems

  • Quality control metrics:

    • Size exclusion chromatography profiles (monodisperse peaks indicate properly folded protein)

    • Dynamic light scattering to assess homogeneity

    • Negative stain electron microscopy for visual inspection of protein particles

When isolated from the ATP synthase complex, the b subunit may not show enzymatic activity but should demonstrate specific binding to other subunits. Interaction studies using surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can confirm these binding properties.

What techniques are most suitable for determining the structure of C. crescentus ATP synthase with focus on the b subunit?

For structural determination of C. crescentus ATP synthase with focus on the b subunit, several complementary approaches are recommended:

TechniqueResolution RangeAdvantagesLimitations
Cryo-EM2.5-4.0 ÅVisualizes intact complex, multiple conformational statesRequires highly pure, homogeneous sample
X-ray Crystallography1.5-3.0 ÅHigh-resolution details of interaction interfacesChallenging for membrane proteins, crystal artifacts
NMR SpectroscopySolution structureDynamics information, solution conditionsLimited to smaller domains or fragments
Cross-linking Mass SpectrometryN/AMaps interaction interfaces, conformational changesLow resolution, requires careful validation

Cryo-EM has proven particularly valuable for bacterial ATP synthase structural studies, as demonstrated with Bacillus PS3 ATP synthase . This approach allows visualization of different rotational states and the conformational changes of the b subunit during the catalytic cycle.

For detailed characterization of specific domains, a divide-and-conquer approach may be useful—expressing and determining structures of individual domains before integrating this information into a comprehensive model of the intact complex.

How does the C. crescentus cell cycle affect ATP synthase expression and function?

The asymmetric life cycle of C. crescentus provides a unique context for studying ATP synthase regulation during developmental transitions. During growth in optimal conditions, protein quality control systems in C. crescentus support a regulated circuit of protein synthesis and degradation that drives cell differentiation and cell cycle progression .

The expression and activity of ATP synthase likely vary between:

  • Swarmer cells: Higher metabolic demands for flagellar motility may require increased ATP synthase activity. Proteomics studies should compare ATP synthase abundance in isolated swarmer cells versus stalked cells.

  • Stalked cells: Different energy requirements during DNA replication and cell division phases may influence ATP synthase regulation.

  • Predivisional cells: Asymmetric distribution of ATP synthase components may prepare daughter cells for their distinct developmental paths.

Experimental approaches to investigate these relationships include:

  • Synchronized cultures for stage-specific analysis

  • Fluorescent tagging of atpF to track localization during the cell cycle

  • Quantitative proteomics to measure abundance changes

  • Metabolic flux analysis to correlate ATP production with developmental stages

How do stress conditions affect C. crescentus ATP synthase structure and function?

When stress conditions threaten the proteome, components of the C. crescentus proteostasis network are upregulated and switch to survival functions that prevent, revert, and remove protein damage, while simultaneously pausing the cell cycle to regain protein homeostasis . This response likely impacts ATP synthase in several ways:

  • Heat stress: May cause conformational changes in ATP synthase subunits, potentially leading to decreased activity. The specialized physiology of C. crescentus influences how it copes with proteotoxic stress, including the management of damaged proteins during recovery .

  • Nutrient limitation: May trigger adaptive responses in ATP synthase expression and activity to conserve energy while maintaining essential functions.

  • Oxidative stress: May cause oxidative damage to ATP synthase components, potentially requiring specific repair mechanisms or increased turnover.

Research approaches should include:

  • Comparative stress tolerance assays between wild-type and ATP synthase mutant strains

  • Quantification of ATP synthase stability and turnover rates under stress

  • Assessment of post-translational modifications induced by stress conditions

  • Identification of stress-specific interacting partners that may regulate ATP synthase function

What are the critical residues in C. crescentus atpF for proper ATP synthase assembly and function?

Based on structural studies of other bacterial ATP synthases, several regions in the b subunit are likely critical for function:

  • N-terminal membrane-anchoring domain: Hydrophobic residues that secure the b subunit in the membrane and interact with subunit a and the c-ring.

  • Dimerization interface: Residues involved in b-b dimerization, typically including a coiled-coil motif that stabilizes the peripheral stalk.

  • F₁-interaction domain: C-terminal residues that interact with the δ and α subunits of the F₁ sector.

Targeted mutagenesis approaches should focus on:

  • Conserved residues identified through multi-species sequence alignment

  • Residues at predicted interaction interfaces based on homology modeling

  • Charged residues that may form salt bridges essential for structural integrity

Functional consequences of mutations can be assessed through:

  • Growth phenotypes under different energy sources

  • ATP synthesis/hydrolysis activity measurements

  • Assembly state analysis using blue native PAGE

  • Protein-protein interaction studies with other ATP synthase components

How can researchers design site-directed mutagenesis experiments to investigate atpF function?

Effective site-directed mutagenesis experiments for C. crescentus atpF should follow a systematic approach:

  • Rational target selection:

    • Conserved residues identified through multiple sequence alignment with other bacterial b subunits

    • Structural hotspots based on homology models or predicted secondary structure

    • Charged residues that may form salt bridges with other subunits

    • Residues at predicted interfaces with other ATP synthase components

  • Mutation design strategy:

    • Conservative substitutions: e.g., Asp→Glu to maintain charge but alter side chain length

    • Charge reversal: e.g., Lys→Glu to disrupt electrostatic interactions

    • Alanine scanning: Systematic replacement with alanine to identify essential side chains

    • Cysteine substitutions: For subsequent crosslinking or labeling experiments

  • Validation approaches:

    • Complementation assays in atpF deletion strains

    • ATP synthesis/hydrolysis measurements in reconstituted systems

    • Protein-protein interaction assays with partner subunits

    • Structural analyses to detect conformational changes

  • Controls:

    • Wild-type protein expressed under identical conditions

    • Multiple independent clones for each mutation

    • Mutations in non-conserved, surface-exposed residues as negative controls

What insights can be gained from comparing atpF sequences across different bacterial species?

Comparative sequence analysis of atpF across bacterial species can reveal:

  • Evolutionary conservation patterns:

    • Core residues preserved across diverse bacteria, indicating essential functional elements

    • Lineage-specific adaptations that may relate to environmental niches or energy requirements

    • Correlation with thermostability (as seen in thermophilic Bacillus PS3 ATP synthase )

  • Structural insights:

    • Secondary structure prediction validation

    • Identification of covariant residues that may indicate interaction interfaces

    • Recognition of sequence motifs associated with specific functions

  • Functional adaptations:

    • Variations that correlate with different energy metabolisms

    • Adaptations specific to the aquatic environment of C. crescentus

    • Sequence features that might relate to the asymmetric cell cycle

A comprehensive phylogenetic analysis should include:

  • Multiple sequence alignment of atpF from diverse bacterial phyla

  • Conservation scoring at each position

  • Identification of C. crescentus-specific sequence features

  • Correlation of sequence variations with ecological niches

How does C. crescentus ATP synthase interact with the cellular protein quality control machinery?

The protein quality control (PQC) network in C. crescentus contains highly conserved ATP-dependent chaperones and proteases as well as more specialized holdases . These systems likely interact with ATP synthase components in several ways:

  • During synthesis and assembly:

    • Chaperones like DnaK/DnaJ may assist in the folding of newly synthesized atpF

    • Assembly factors may facilitate incorporation into the ATP synthase complex

    • Proteases may degrade excess or misfolded subunits to maintain stoichiometry

  • During normal operation:

    • Surveillance mechanisms may monitor ATP synthase integrity

    • Regular turnover of components may ensure optimal function

    • Post-translational modifications may regulate activity

  • Under stress conditions:

    • Upregulation of chaperones to prevent aggregation or misfolding

    • Increased proteolytic activity to remove damaged components

    • Possible pausing of ATP synthase synthesis during extreme stress

Experimental approaches should include:

  • Co-immunoprecipitation to identify interacting PQC components

  • Pulse-chase experiments to measure synthesis and turnover rates

  • Genetic screens for synthetic interactions between ATP synthase and PQC components

  • Stress response studies focusing on ATP synthase stability

What methodologies are recommended for studying the dynamics of ATP synthase assembly in C. crescentus?

To study the dynamics of ATP synthase assembly in C. crescentus, researchers should consider multi-faceted approaches:

  • Temporal analysis of assembly:

    • Pulse-chase labeling combined with blue native PAGE

    • Time-resolved mass spectrometry to track assembly intermediates

    • Conditional expression systems to synchronize assembly initiation

  • Spatial organization:

    • Super-resolution microscopy to visualize assembly sites

    • Subcellular fractionation to identify assembly compartments

    • Fluorescence recovery after photobleaching (FRAP) to measure mobility

  • Assembly factors identification:

    • Proximity labeling techniques (BioID, APEX) to identify transient interactors

    • Genetic screens for assembly-defective mutants

    • Comparative proteomics between assembly-competent and defective conditions

  • In vitro reconstitution:

    • Step-wise addition of purified components to reconstitute assembly

    • Single-molecule techniques to observe assembly events in real-time

    • Cryo-EM to capture assembly intermediates

These approaches should be integrated with cell cycle synchronization methods to determine if assembly dynamics vary during the dimorphic lifecycle of C. crescentus.

How do proteotoxic stresses affect C. crescentus ATP synthase stability and turnover?

When stress conditions threaten the proteome, components of the C. crescentus proteostasis network are upregulated and switch to survival functions . The effects on ATP synthase likely include:

  • Heat stress effects:

    • Increased risk of misfolding for ATP synthase components

    • Potential disassembly of the complex under severe heat shock

    • Recruitment of heat shock proteins (HSPs) to stabilize the complex

  • Oxidative stress impact:

    • Oxidative damage to sensitive residues (cysteines, methionines)

    • Potential carbonylation of subunits leading to inactivation

    • Increased turnover rates for damaged components

  • Proteotoxic stress response:

    • Pausing of ATP synthase synthesis to prioritize essential proteins

    • Increased surveillance by quality control machinery

    • Selective degradation of damaged components

Research approaches should include:

  • Quantitative proteomics to measure abundance changes under stress

  • Pulse-chase experiments to determine turnover rates

  • Post-translational modification mapping before and after stress

  • Genetic screens for mutants with altered ATP synthase stability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.