Recombinant Caulobacter crescentus Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Description

Gene Locus and Protein Structure

  • Gene Locus: fliP is part of the orfX-fliP locus, a dual open reading frame (ORF) system .

  • Protein Length: Encodes a 264-amino-acid polypeptide .

  • Homology: Shows sequence identity with Escherichia coli FliP and virulence proteins from pathogens like Erwinia carotovora (MopB), Shigella flexneri (Spa9/29), and Yersinia pestis (YscS) .

FeatureDescriptionSource
Gene OrganizationAdjacent to orfX in a divergent promoter region with flgB .
Promoter CharacteristicsUnique promoter sequence lacking conserved elements seen in other flagellar genes .
Transcription Start Site53 bases upstream of the flgB promoter in a compact divergent arrangement .

Flagellar Biogenesis

  • Motility: Essential for polar flagellum assembly; mutants exhibit non-motile, filamentous phenotypes .

  • Cell Division: Disruption leads to defects in predivisional cell separation, linking flagellar genes to division machinery .

  • Protein Targeting: Localizes specifically to the swarmer cell pole during the cell cycle .

RoleMechanismSource
Flagellar ExportShares homology with secretion systems for virulence factors in pathogens .
Hierarchical RegulationRequired for expression of class III/IV flagellar genes .

Cell Cycle Control

  • Expression Timing: Transcription peaks mid-cell cycle, with bimodal expression in predivisional cells (both poles) .

  • Regulatory Protein: CtrA activates transcription via direct promoter binding, contrasting its repressive role on the divergent flgB promoter .

RegulatorEffect on fliPSource
CtrAActivates transcription; deletion reduces expression levels .
FlbDIndirectly regulates via hierarchical control of flagellar genes .

Functional Conservation

  • Export Pathway Homology: Shares structural and functional similarities with virulence secretion systems (e.g., type III secretion systems) .

  • Divergent Promoter Strategy: Compact flgB-fliP promoter region enables precise temporal regulation, unlike larger class II-class III divergent promoters .

Homologous SystemOrganismFunctionSource
MopBErwinia carotovoraMotility and virulence factor secretion .
Spa9/29Shigella flexneriVirulence protein export .

Experimental Insights

  • Recombinant Studies: Recombinant fliP has been used to study secretion mechanisms, though commercial products like FliQ (CC_1075) highlight related flagellar biosynthetic proteins .

  • Regulatory Complexity: The compact promoter region complicates dissection of transcriptional controls, requiring advanced mutational analyses .

ChallengeApproachSource
Promoter SpecificityDual-reporter systems reveal divergent flgB-fliP expression timing .
Functional RedundancyEpistasis experiments confirm fliP’s upstream role in flagellar hierarchy .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fliP; CC_0951; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Caulobacter crescentus (strain ATCC 19089 / CB15)
Target Names
fliP
Target Protein Sequence
MIRDLFKSVIGAKAEDLRRAAIISVLAAIACAIMPAAAMAQSAVNINLGTGAGLTERVVQ LVGLMTVLSLAPSIVIMTTSFVRIVVVLGLLRTAIGVQQSPPNPVLISLALFLTAIVMAP TFERSYDAGIKPLLDQQMELPEAFEAASGPVKQFMLSQVDRDDLALFVRLSKIPQPRTAA ETPLRVVTPAFMISELKRAFEIGFLLFIPFLVIDLVVASVLMSMGMMMLPPASISLPFKL IFFVLVDGWRLVAGSLVESFQRGAGG
Uniprot No.

Target Background

Function
FliP may be a component of the flagellum and is required for normal cell division. It may be implicated in the secretion of virulence factors.
Database Links

KEGG: ccr:CC_0951

STRING: 190650.CC_0951

Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the FliP protein and what is its fundamental role in Caulobacter crescentus?

FliP is an early flagellar biosynthetic protein in Caulobacter crescentus that belongs to the class II flagellar genes. The protein is encoded within the orfX-fliP locus and is essential for both flagellar assembly and normal cell division. The deduced amino acid sequence of FliP is 264 amino acids in length and shows significant sequence identity with the FliP protein of Escherichia coli, as well as virulence proteins from several plant and mammalian pathogens .

FliP functions at an early step in flagellar biogenesis and is believed to be part of a protein export system required for flagellum assembly. Mutations in the fliP gene result in cells that fail to express class III and IV flagellar genes, which are necessary for later stages of flagellar construction . Additionally, strains with mutations in the orfX-fliP locus exhibit a filamentous growth phenotype, indicating a defect in cell division processes .

How is FliP expression regulated during the Caulobacter cell cycle?

The expression of fliP in C. crescentus is tightly regulated during the cell cycle. The orfX-fliP locus is transcribed under cell cycle control, with a peak of transcriptional activity occurring in the middle portion of the cell cycle . This temporal regulation ensures that flagellar components are produced at the appropriate time for assembly.

The promoter sequence upstream of the orfX-fliP locus shares few conserved features with other early Caulobacter flagellar genes, suggesting that transcription may require a different set of trans-acting factors .

What is the relationship between FliP and virulence factors in bacterial pathogens?

FliP homologs in pathogenic bacteria have been implicated in the secretion of virulence factors, suggesting a common evolutionary origin and mechanistic relationship between flagellar protein export and virulence factor secretion systems . The significant sequence identity between C. crescentus FliP and virulence proteins in plant and mammalian pathogens points to a conserved functional role across bacterial species .

For example, the FliP homolog in Erwinia carotovora (a plant pathogen) functions in the secretion of virulence factors. Similarly, homologs exist in Shigella flexneri (Spa9) and Yersinia pestis (YscS) . This relationship suggests that studying FliP in the non-pathogenic model organism C. crescentus can provide insights into virulence mechanisms in pathogenic bacteria.

How does FliP contribute to the flagellar export apparatus structure and function?

FliP is believed to be an integral membrane component of the flagellar export apparatus, functioning as part of a specialized protein secretion system that translocates flagellar components from the cytoplasm to the site of flagellar assembly . Research indicates that FliP works in conjunction with other membrane proteins, including FliQ and FliR, which are encoded by genes in the same operon structure in some bacteria .

Together, these proteins form a membrane-embedded complex that serves as a conduit for the export of flagellar proteins required for assembly. The precise molecular architecture of this complex and the specific role of FliP within it remain areas of active research. Based on sequence analysis, FliP likely contains multiple transmembrane domains that anchor it within the cytoplasmic membrane, positioned to facilitate protein export .

Experimental approaches to study this structure-function relationship typically involve creating targeted mutations in specific domains of FliP, followed by analysis of flagellar assembly phenotypes and protein interaction studies.

What phenotypic consequences result from fliP mutations in Caulobacter crescentus?

Mutations in the fliP gene in C. crescentus result in multiple phenotypic defects:

PhenotypeDescriptionMechanism
Loss of motilityCells are non-motileFailure to construct functional flagellum
Gene expression defectsInability to express class III and IV flagellar genesDisruption of the hierarchical flagellar gene expression cascade
Filamentous growthElongated cells that fail to divide properlyPerturbation of cell division mechanisms
Defective protein secretionReduced export of flagellar proteinsCompromised flagellar export apparatus function

These phenotypes highlight the dual role of FliP in both flagellar biogenesis and cell division processes . The exact mechanism linking flagellar assembly and cell division in C. crescentus remains incompletely understood, but evidence suggests that components of the flagellar export apparatus, including FliP, may directly or indirectly participate in the division process .

How do surface sensing mechanisms relate to flagellar function in Caulobacter?

Recent research has identified connections between flagellar function and surface sensing mechanisms in C. crescentus. While not directly focused on FliP, these studies provide context for understanding the broader functional network in which FliP operates.

The flagellar accessory protein FssF has been identified as a link between chemotaxis and surface sensing in C. crescentus . FssF shows homology to the flagellar C-ring protein FliN (which is part of the same flagellar system as FliP) and localizes to the flagellated pole of the cell. This localization requires all components of the flagellar C-ring for proper positioning .

Deletion of fssF results in a severe motility defect due to disruption of chemotaxis. Additionally, disruption of chemotaxis through deletion of fssF or other chemotaxis genes leads to a hyperadhesion phenotype, suggesting that the flagellar apparatus serves both motility and sensing functions .

These findings support a model in which the stator subunits of the flagella incorporate both mechanical and chemical signals to regulate adhesion. Understanding how FliP contributes to this integrated system represents an important research direction .

What are optimal approaches for expressing and purifying recombinant Caulobacter FliP?

Researchers studying recombinant C. crescentus FliP must address several challenges inherent to membrane protein expression and purification:

  • Expression system selection: While E. coli expression systems are commonly used for recombinant protein production, membrane proteins like FliP may benefit from expression in systems more suited to membrane protein folding, such as C. crescentus itself for homologous expression.

  • Affinity tag placement: Strategic placement of affinity tags (His, FLAG, etc.) is critical, as improper positioning may interfere with membrane insertion or protein function. Both N-terminal and C-terminal tagging strategies should be evaluated.

  • Detergent selection: Effective solubilization of FliP from membranes requires careful detergent selection. A panel of detergents including mild options (DDM, LMNG) and stronger alternatives (Triton X-100, SDS) should be tested to identify conditions that maintain native structure.

  • Purification strategy: A two-step purification approach is recommended, combining affinity chromatography (utilizing engineered affinity tags) with size exclusion chromatography to achieve high purity.

For functional studies, researchers should consider reconstituting purified FliP into proteoliposomes or nanodiscs to maintain a membrane-like environment that better preserves native protein activity .

How can researchers effectively generate and analyze fliP mutants?

Creating and characterizing fliP mutants in C. crescentus requires systematic approaches:

  • Mutation strategy design: Both deletion mutations and site-directed mutagenesis should be considered. For investigating specific functional domains, targeted amino acid substitutions based on sequence conservation analysis provide valuable insights.

  • Complementation testing: After generating mutations, complementation with wild-type fliP on a plasmid can confirm phenotype specificity. Complementation experiments have been used effectively to characterize the orfX-fliP locus in previous studies .

  • Phenotypic analysis: Comprehensive phenotypic characterization should include:

    • Motility assays (swimming plates, microscopic tracking)

    • Cell morphology examination (phase contrast, electron microscopy)

    • Flagellar gene expression analysis (using reporter fusions)

    • Cell division pattern assessment

  • Protein localization studies: Fluorescent protein fusions can be used to track FliP localization, similar to approaches used with FssF-Venus fusions in related studies . Care must be taken to ensure fusions do not disrupt protein function.

Such approaches have successfully identified that strains with mutations in the orfX-fliP locus exhibit both flagellar assembly defects and cell division abnormalities .

What techniques are most effective for studying cell cycle-dependent expression of fliP?

Investigating the temporal and spatial regulation of fliP expression requires specialized techniques:

  • Synchronization methods: Research on fliP regulation relies on obtaining synchronized C. crescentus populations. Density gradient centrifugation can isolate swarmer cells, which then progress synchronously through the cell cycle, allowing time-course sampling.

  • Transcriptional analysis:

    • RT-qPCR to quantify fliP transcript levels at different cell cycle stages

    • Northern blotting for mRNA size and stability assessment

    • Promoter-reporter fusions (using lacZ, gfp, etc.) to visualize transcriptional activity

  • Promoter analysis: Determination of the 5' end of orfX-fliP mRNA has revealed upstream promoter sequences with unique features, suggesting specialized transcriptional regulation. Deletion analysis has shown that the minimal sequence required for transcriptional activation resides within 59 bp of the start site .

  • Protein expression tracking: Immunoblotting with FliP-specific antibodies or tracking fluorescently tagged FliP can demonstrate protein production timing and cellular compartmentalization.

Studies using these approaches have revealed that orfX-fliP transcription peaks in the middle portion of the cell cycle, with later expression occurring at both poles of the predivisional cell .

How can the relationship between FliP and flagellar assembly be visualized?

Visualization techniques provide critical insights into FliP function:

  • Fluorescence microscopy: Tagging FliP with fluorescent proteins enables live-cell imaging of its localization during flagellar assembly. Both wide-field and super-resolution approaches (STORM, PALM) can be applied for different resolution needs.

  • Cryo-electron microscopy: This technique can visualize the nascent flagellar structure in wild-type versus fliP mutant cells, revealing structural defects at high resolution.

  • Immunogold electron microscopy: Using FliP-specific antibodies conjugated to gold particles allows precise localization within the cellular ultrastructure.

  • FRAP and photoactivation: These techniques can assess FliP dynamics and turnover during flagellar assembly.

  • Co-localization studies: Dual-color imaging with other flagellar components can reveal the temporal sequence of protein recruitment during assembly.

Protein fusion studies using reporter genes have demonstrated that FliP is specifically targeted to the swarmer compartment of the predivisional cell, highlighting the asymmetric distribution essential for Caulobacter's dimorphic lifecycle .

How is FliP conserved across bacterial species, and what does this reveal about flagellar evolution?

FliP represents a highly conserved component of the bacterial flagellar system, with homologs identified across diverse bacterial lineages. Comparative sequence analysis reveals:

  • C. crescentus FliP shows significant sequence identity with the FliP protein of Escherichia coli, indicating conservation across alpha and gamma proteobacteria .

  • FliP homologs have been identified in various pathogenic bacteria, including:

    • MopD protein in Erwinia carotovora (plant pathogen)

    • Spa9 protein in Shigella flexneri (human pathogen)

    • YscS protein in Yersinia pestis (human pathogen)

This conservation extends beyond flagellar systems to type III secretion systems involved in virulence factor export, suggesting an evolutionary relationship between these protein export mechanisms .

The dual functionality of FliP in both flagellar assembly and cell division in C. crescentus suggests that components of the flagellar apparatus may have been coopted for additional cellular functions during evolution . This functional diversity highlights the adaptability of core bacterial cellular machinery.

What research contradictions exist in the current understanding of FliP function?

Several unresolved questions and apparent contradictions exist in the current understanding of FliP:

  • Dual functionality paradox: How does FliP simultaneously contribute to both flagellar assembly and cell division? The mechanism linking these seemingly distinct processes remains incompletely understood .

  • Regulatory contradictions: The promoter sequence of the orfX-fliP locus differs from other Caulobacter flagellar gene promoters, suggesting unique regulatory mechanisms. This raises questions about how these genes are integrated into the broader flagellar regulatory hierarchy .

  • Localization vs. function: Research shows that FliP is targeted to the swarmer compartment of predivisional cells , but how this specific localization relates to its function in the flagellar export apparatus requires further investigation.

  • Virulence connection: The relationship between FliP's role in flagellar assembly and its homologs' functions in virulence factor secretion presents an evolutionary puzzle. Whether these represent convergent or divergent evolution remains debated .

Resolving these contradictions will require integrated approaches combining structural biology, genetics, cell biology, and evolutionary analysis.

What emerging technologies might advance our understanding of FliP structure and function?

Several cutting-edge technologies hold promise for deepening our understanding of FliP:

  • Cryo-electron tomography: This technique can visualize the native structure of the flagellar export apparatus within intact cells, potentially revealing FliP's position and interactions.

  • Single-molecule tracking: Super-resolution microscopy combined with photoactivatable fluorophores can track individual FliP molecules during flagellar assembly.

  • Cross-linking mass spectrometry: This approach can identify FliP interaction partners and map protein-protein interfaces within the export apparatus complex.

  • AlphaFold and structural prediction: AI-based structural prediction tools may provide insights into FliP's tertiary structure when experimental structure determination proves challenging.

  • Genome-wide genetic interaction screens: CRISPRi or transposon-sequencing approaches could identify synthetic genetic interactions with fliP, revealing functional connections to other cellular processes.

These technologies would complement existing approaches and potentially resolve current contradictions in our understanding of FliP function .

How might understanding FliP inform applications in synthetic biology and biotechnology?

Research on FliP has several potential applications:

  • Engineered protein secretion systems: Understanding FliP's role in the flagellar export apparatus could enable the design of customized protein secretion systems for biotechnological applications.

  • Targeted antimicrobial development: The essential role of FliP in bacterial motility and its conservation across species makes it a potential target for novel antimicrobial compounds.

  • Cell division regulation: Insights into how FliP influences cell division could inform strategies for manipulating bacterial growth and reproduction.

  • Biosensor development: The connection between flagellar function and surface sensing (as seen with FssF ) suggests potential applications in creating bacterial biosensors that respond to surface contact.

  • Vaccine development: Understanding the relationship between flagellar export and virulence factor secretion could inform attenuated pathogen design for vaccine development.

These applications represent the translational potential of basic research on flagellar biosynthetic proteins like FliP .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.