Recombinant Caulobacter crescentus Flagellar biosynthetic protein fliR (fliR)

Shipped with Ice Packs
In Stock

Description

Biological Function

FliR is essential for:

  • Flagellar Biogenesis: Acts in an early step of flagellar assembly, likely facilitating the export of flagellar components via a type III secretion-like system .

  • Cell Division: Mutations in fliR disrupt cell division, linking flagellar assembly to cell cycle progression .

  • Regulatory Hierarchy: Class II flagellar gene, transcribed in predivisional cells under the control of a unique promoter (-10, -20 to -30, and -35 regions) .

Key Research Findings:

  • Promoter Analysis: The fliQR operon’s promoter requires a 59-bp sequence for activation, with conserved nucleotides critical for transcriptional timing .

  • Protein Interaction: FliR partners with FliQ to form a membrane complex homologous to virulence export systems (e.g., Yersinia pestis YscS) .

  • Instability in Mutants: In flgI (P-ring) mutants, FliR-dependent L-ring protein (FlgH) becomes unstable, highlighting its role in structural coordination .

Table 2: Functional Studies of FliR

Study FocusMethodologyKey Outcome
Transcriptional TimingPromoter deletion/mutation analysisMinimal 59-bp region required for activation
Membrane Localizationβ-lactamase fusion assaysConfirmed membrane association
Cell Cycle DefectsfliR knockout mutantsDelayed cell division and flagellar loss

Applications in Research

Recombinant FliR is utilized for:

  • Antibody Production: Commercial ELISA kits employ recombinant FliR to generate specific antibodies .

  • Mechanistic Studies: Used to dissect flagellar assembly pathways and cell cycle regulation in C. crescentus .

  • Comparative Analyses: Structural homology studies with virulence exporters (e.g., Shigella Spa29) inform bacterial pathogenesis mechanisms .

Technical Considerations

  • Storage: Recombinant FliR is sensitive to freeze-thaw cycles; working aliquots should be stored at 4°C for ≤1 week .

  • Expression Challenges: Hydrophobic domains necessitate codon optimization and membrane fractionation during purification .

Research Gaps and Future Directions

  • Structural Resolution: No high-resolution structure of FliR exists; cryo-EM studies could elucidate its export mechanism.

  • Regulatory Links: How FliR integrates flagellar biogenesis with cell division remains unclear .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
fliR; CC_1076; Flagellar biosynthetic protein FliR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Caulobacter crescentus (strain ATCC 19089 / CB15)
Target Names
fliR
Target Protein Sequence
MNAFATAFQVYVAALVFARVGAMVMTMPGIGDQAIPARIRLSFALLMALILAPLVQNTVG PIPSTLGGLGGAVIHEVLIGLMIGSVLRLFMTSLTTAGEIISMQTTLSFAQSTNPSMEGS STAVATFLSMLGLTLVMATDLHHLFIAAIVKSYTIFPFTRAVPVNDAAALAVQTVAQSFS LGVQLAAPVIVFSLVFNLATGLVGRIMPAFQIFFVASPLSVILGLSLLALSLSGIAMVWT DRYRELLDIFT
Uniprot No.

Target Background

Function
Involved in flagellar biosynthesis.
Database Links

KEGG: ccr:CC_1076

STRING: 190650.CC_1076

Protein Families
FliR/MopE/SpaR family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is FliR and what is its role in Caulobacter crescentus?

FliR is a membrane protein encoded by the fliR gene in Caulobacter crescentus that plays a crucial role in the early steps of flagellar biogenesis. It belongs to a family of proteins implicated in the export of virulence factors, including the MopD and MopE proteins from Erwinia carotovora, the Spa9 and Spa29 proteins from Shigella flexneri, and the YscS protein from Yersinia pestis . This protein family association suggests that FliR participates in an export pathway required for flagellum assembly. The protein is classified as a class II flagellar gene, positioning it near the top of the regulatory hierarchy that determines the sequential order of flagellar gene transcription during C. crescentus development .

How is the fliR gene organized in the Caulobacter genome?

The fliR gene exists as part of the fliQR operon in Caulobacter crescentus. This operon contains two genes, fliQ and fliR, which are transcribed together from a shared promoter . Interestingly, the fliQR operon is positioned in a divergent orientation from another important flagellar operon containing fliP, which encodes a component of the flagellum-specific protein export apparatus . The transcription start sites of these two operons are separated by only 53 bases, suggesting possible coordinated regulation . This organization is notable because both operons encode proteins that function together in the flagellar export system, despite being transcribed in opposite directions.

What is the regulatory classification of the fliR gene in the flagellar hierarchy?

FliR is classified as a class II flagellar gene in Caulobacter crescentus, positioning it near the top of the regulatory hierarchy that controls flagellum assembly . The flagellar regulon in C. crescentus is arranged in a rigid hierarchical order of gene expression, where successful expression of early genes is required for the expression of later genes . This hierarchy mirrors the assembly sequence of gene products into the completed flagellum. While most class II genes require completion of class I expression, promoter analysis, timing of expression, and epistasis experiments suggest that the fliQR operon shows some unique properties, as it is expressed in class II mutants, and deletions of related genes like flgB do not prevent class III gene expression .

What is known about the promoter sequence of the fliQR operon?

The promoter sequence of the fliQR operon differs from most known bacterial promoter sequences but shares similarities with other Caulobacter class II flagellar gene promoter sequences . The conserved nucleotides in the promoter region are clustered in the -10, -20 to -30, and -35 regions relative to the transcription start site . Mutational analysis has demonstrated the importance of these conserved bases for promoter activity. Deletion analysis revealed that the minimal sequence required for transcriptional activation resides within 59 base pairs of the start site . Additionally, footprint assays on DNA fragments containing related operons, as well as in vivo mutant suppressor analysis of promoter mutations, indicate that flagellar operons are controlled by the cell cycle response regulator CtrA, which works with σ70 to regulate transcription of early flagellar genes in C. crescentus .

How does FliR contribute to the flagellar export apparatus structure and function?

FliR is a membrane protein that forms part of the flagellar type III secretion system (T3SS), which is essential for the export of flagellar components through the bacterial inner membrane during flagellum assembly. Based on studies of flagellar biogenesis, FliR likely interacts with other membrane components of the export apparatus, including FliP, FliQ, and FlhA, to form a protein complex embedded in the cytoplasmic membrane . This complex creates a selective channel for the translocation of flagellar proteins from the cytoplasm to the periplasmic space and beyond. The sequential assembly of the flagellum requires the proper functioning of this export apparatus, with FliR playing a crucial early role. Mutations in fliR result in cells that cannot assemble flagella, supporting its essential role in the export process . Recent structural studies in related systems suggest FliR contributes to the formation of a ring-like structure in the inner membrane that serves as the core of the export gate complex.

What is the relationship between FliR function and cell division in Caulobacter crescentus?

A particularly intriguing aspect of FliR research is that mutations in either fliQ or fliR not only disrupt flagellar biogenesis but also exhibit defects in cell division, suggesting these proteins may participate directly or indirectly in the division process . This dual functionality points to a potential molecular link between flagellar assembly and cell cycle progression in Caulobacter. The nature of this relationship remains under investigation, but several hypotheses exist:

  • FliR may interact with cell division proteins or affect their localization

  • The flagellar export apparatus may share components with or influence the assembly of the divisome

  • Regulatory pathways controlling flagellar gene expression may also modulate cell division genes

  • Membrane organization disruptions caused by fliR mutations might affect both processes

Research exploring this relationship may provide insights into the coordination between morphogenesis and cell cycle progression in Caulobacter crescentus, particularly how polar development is integrated with cell division .

How is the transcription of the fliR gene temporally regulated during the Caulobacter cell cycle?

Transcription of the fliQR operon is initiated at a specific time in the Caulobacter cell cycle, consistent with the temporal regulation of flagellar gene expression . This temporal control is part of the sophisticated developmental program in C. crescentus, which includes distinct swarmer and stalked cell phases. The cell cycle-controlled biogenesis of the single polar flagellum is a hallmark of this developmental program .

The fliQR operon is controlled by the cell cycle response regulator CtrA, which works with σ70 to regulate transcription of early flagellar genes . CtrA is a master regulator whose activity and abundance are tightly controlled during the cell cycle. It binds to specific sequences in the promoter regions of target genes, including flagellar genes, and activates their transcription at appropriate times.

The timing of fliR expression correlates with early stages of flagellar assembly, reflecting its role in establishing the export apparatus necessary for subsequent flagellar protein translocation. Temporal expression studies have revealed that FliR protein and the ftr-binding protein are primarily restricted to the predivisional cell, which is the cell type in which many flagellar promoters are transcribed . This predivisional-specific expression pattern ensures that flagellar assembly occurs at the appropriate time in the cell cycle.

What structural homologies exist between FliR and virulence factor export proteins in pathogenic bacteria?

FliR shares significant structural and functional homology with proteins involved in virulence factor export in several pathogenic bacteria. These include the MopD and MopE proteins from Erwinia carotovora, the Spa9 and Spa29 proteins from Shigella flexneri, and the YscS protein from Yersinia pestis . This homology extends beyond sequence similarity to predicted structural features, particularly membrane-spanning domains and charged residues that are likely important for protein-protein interactions within the export apparatus.

The structural conservation between flagellar export proteins and virulence factor secretion systems reflects the evolutionary relationship between these two types of type III secretion systems (T3SS). Both systems form multi-protein complexes that span the bacterial envelope and facilitate the transport of proteins across the membrane barriers. The conservation of FliR across these systems suggests it plays a fundamental role in the architecture and function of the export apparatus.

This homology has significant implications for understanding bacterial pathogenesis mechanisms and potentially developing broad-spectrum antimicrobial strategies targeting conserved components of protein export systems. Structural studies comparing FliR with its homologs in virulence factor export systems may reveal conserved functional domains that could be targeted for therapeutic intervention.

What expression systems are most effective for producing recombinant FliR protein?

Producing recombinant FliR presents several challenges due to its nature as a membrane protein with multiple transmembrane domains. Based on approaches used for similar membrane proteins, the following expression systems and methodologies are recommended:

Table 1: Comparison of Expression Systems for Recombinant FliR Production

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3)High yield, cost-effective, rapid growthMembrane protein toxicity, inclusion body formationUse C41/C43 strains derived from BL21, lower induction temperature (16-20°C), add detergents like DDM or LDAO
C. crescentus homologous expressionNative folding environment, proper post-translational modificationsLower yield, more complex cultivationUse inducible promoters like xylose or vanillate, optimize growth conditions for C. crescentus
Cell-free protein synthesisAvoids toxicity issues, direct incorporation into nanodiscs or liposomesHigher cost, lower yieldAdd liposomes or nanodiscs during synthesis, optimize reaction conditions
Bacillus subtilisBetter secretion of membrane proteins, less inclusion body formationDifferent codon usage, potential proteolysisUse protease-deficient strains, optimize signal sequences

For optimal results with E. coli-based systems, consider the following protocol modifications:

  • Use a low-copy plasmid with tightly controlled promoter (T7lac or arabinose-inducible)

  • Fuse FliR with solubility tags such as MBP, SUMO, or TrxA

  • Co-express with chaperones like GroEL/GroES

  • Induce at OD600 = 0.6-0.8 with reduced inducer concentration

  • Incorporate membrane-mimicking environments during purification

The choice of expression system should be guided by the intended experimental applications for the recombinant protein .

What are the most effective methods for studying FliR-protein interactions in the flagellar export apparatus?

Several complementary approaches can be used to study FliR-protein interactions within the flagellar export apparatus:

Chemical Crosslinking coupled with Mass Spectrometry (XL-MS): This approach involves using membrane-permeable crosslinkers like DSS or formaldehyde to stabilize protein-protein interactions in vivo, followed by membrane protein extraction, digestion, and mass spectrometric analysis. This technique can identify interaction partners and potentially map interaction interfaces between FliR and other flagellar proteins.

Bacterial Two-Hybrid (BTH) Analysis: Modified BTH systems designed for membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid) can detect interactions between FliR and potential partners. This system works by fusing candidate proteins to separate fragments of adenylate cyclase, which upon interaction, reconstitute enzyme activity that can be detected through reporter gene expression.

Co-immunoprecipitation with Membrane Protein Adaptations: Using epitope-tagged versions of FliR (with tags like FLAG, HA, or Myc) expressed in C. crescentus, followed by gentle solubilization with appropriate detergents (DDM, LMNG, or digitonin) and immunoprecipitation with tag-specific antibodies. Interacting partners can be identified by Western blotting or mass spectrometry.

Cryo-Electron Microscopy: For structural studies of the entire export apparatus complex, cryo-EM has emerged as a powerful technique that can resolve membrane protein complexes in near-native states without crystallization. This approach has been successfully applied to related secretion systems and could reveal the structural arrangement of FliR within the flagellar export apparatus.

Genetic Suppressor Analysis: Introducing mutations in fliR and screening for suppressor mutations in other flagellar genes can identify functionally interacting proteins. This approach has been particularly useful in dissecting protein interactions within complex assemblies like the flagellum.

When implementing these techniques, it is essential to validate interactions using multiple independent methods and to consider the membrane environment's effects on protein-protein interactions .

How can site-directed mutagenesis be used to analyze FliR function in flagellar assembly?

Site-directed mutagenesis represents a powerful approach for dissecting the structure-function relationships of FliR in flagellar assembly. Based on bioinformatic analyses and structural predictions, key residues can be targeted for mutation to analyze their impact on FliR function:

Conserved Residues: Alignment of FliR sequences across bacterial species reveals highly conserved amino acids that likely play critical functional or structural roles. These conserved residues should be prioritized for mutagenesis studies.

Transmembrane Domains: Hydrophobicity analysis predicts multiple transmembrane segments in FliR. Mutations that alter the hydrophobicity or introduce charged residues within these segments can disrupt membrane integration and affect protein function.

Charged Residues in Cytoplasmic and Periplasmic Loops: Charged amino acids in the loop regions often mediate protein-protein interactions or substrate recognition. Charge reversal mutations (e.g., Asp to Lys) can be particularly informative.

Experimental Protocol:

  • Generate a complementation construct containing wild-type fliR under its native promoter

  • Create a series of point mutations using PCR-based site-directed mutagenesis

  • Introduce the constructs into a C. crescentus fliR deletion strain

  • Assess flagellar assembly and function through:

    • Motility assays on semi-solid agar

    • Electron microscopy to visualize flagellar structures

    • Western blotting to confirm protein expression

    • Immunofluorescence to examine protein localization

    • Flagellar protein export assays to measure secretion efficiency

Analysis of Results: The effects of mutations can be classified into several categories:

  • Null phenotypes: Complete loss of flagellar assembly

  • Partial function: Reduced motility or abnormal flagella

  • Localization defects: Improper positioning of FliR

  • Assembly-competent but export-defective: Intact basal body but no filament

  • Conditional phenotypes: Temperature-sensitive mutations

This systematic mutagenesis approach can map the functional domains of FliR and identify specific residues critical for protein-protein interactions, membrane integration, and export function .

What cell cycle synchronization methods are most appropriate for studying temporal expression of the fliR gene?

Given that fliR expression is cell cycle-regulated in Caulobacter crescentus, proper cell synchronization methods are crucial for studying its temporal expression pattern. The following techniques have proven effective for C. crescentus synchronization:

Density Gradient Centrifugation: This classic method exploits the different densities of swarmer and stalked cells. A culture is separated on a Ludox or Percoll gradient, allowing for the isolation of swarmer cells from the less dense stalked and predivisional cells. While effective, this method has limited yield and purity.

Adhesion Selection: Swarmer cells can be enriched based on their ability to adhere to surfaces like glass or plastic. Cultures are allowed to attach to a surface, non-attached cells are washed away, and the remaining cells divide to produce a synchronized population of swarmer cells that can be collected.

Plate Release Technique: Cells are grown on agar plates, then gently washed off. Since swarmer cells are more easily released from the surface, this provides an enriched swarmer cell population with minimal disturbance to cellular physiology.

Filtration Synchronization Protocol:

  • Grow C. crescentus cultures to mid-log phase (OD600 ≈ 0.4-0.6) in PYE or M2 minimal medium at 31°C

  • Pass the culture through a 0.8 μm filter to selectively retain predivisional and stalked cells while allowing swarmer cells to pass through

  • Collect the filtrate containing enriched swarmer cells

  • Resuspend cells in fresh medium and incubate at 31°C

  • Collect samples at 20-minute intervals for at least one complete cell cycle (approximately 150 minutes)

  • Extract RNA for RT-qPCR or prepare samples for immunoblotting to monitor fliR expression

Analysis Methods:

  • RT-qPCR to quantify fliR mRNA levels

  • Western blotting with anti-FliR antibodies to track protein abundance

  • Fluorescence microscopy using FliR-fluorescent protein fusions

  • Chromatin immunoprecipitation (ChIP) to monitor CtrA binding to the fliR promoter throughout the cell cycle

These synchronization methods enable precise temporal analysis of fliR expression and correlation with specific cell cycle stages and morphological transitions .

How do post-translational modifications affect FliR function in flagellar assembly?

While post-translational modifications (PTMs) of FliR have not been extensively characterized, emerging research in bacterial membrane proteins suggests that PTMs may play important roles in regulating protein function, stability, and interactions. Potential PTMs that might affect FliR include:

Phosphorylation: Serine, threonine, or tyrosine residues in cytoplasmic domains of FliR could be phosphorylated by bacterial kinases. Phosphorylation might regulate interactions with other flagellar proteins or modulate export activity in response to environmental signals. Mass spectrometry-based phosphoproteomics can identify phosphorylation sites, while phosphomimetic mutations (S/T to D/E) can be used to study the functional effects.

Proteolytic Processing: Some membrane components undergo proteolytic cleavage as part of their maturation or regulation. N-terminal or C-terminal processing of FliR could affect its membrane topology or interaction capabilities. Protein sequencing of native FliR can reveal if any processing occurs.

Disulfide Bond Formation: Cysteine residues in periplasmic domains might form disulfide bonds that stabilize protein structure. These bonds could be important for maintaining the conformation of export channel components. Mutating cysteine residues to serine can disrupt these bonds and reveal their functional significance.

Lipid Modifications: Although less common in bacterial inner membrane proteins, lipid modifications like palmitoylation could affect membrane association or protein-protein interactions within the lipid bilayer.

Research methodologies to investigate PTMs in FliR include:

  • Immunoprecipitation of epitope-tagged FliR followed by mass spectrometry

  • Site-directed mutagenesis of potential modification sites

  • In vitro biochemical assays with purified FliR protein

  • Comparison of FliR modifications across different growth conditions or cell cycle stages

Understanding PTMs of FliR could provide new insights into the regulatory mechanisms controlling flagellar assembly and potentially reveal novel strategies for manipulating this process .

What is the impact of environmental and stress conditions on fliR expression and function?

Environmental and stress conditions significantly impact flagellar gene expression in many bacteria, but their specific effects on fliR expression and function in Caulobacter crescentus remain an active area of investigation. Several environmental factors likely influence fliR expression:

Nutrient Availability: Nutrient limitation often triggers changes in motility as an adaptive response. During carbon starvation, Caulobacter may regulate flagellar gene expression, potentially including fliR, to conserve energy while maintaining essential motility functions. Experiments comparing rich media (PYE) versus minimal media (M2) growth conditions can reveal how nutrient availability affects fliR expression .

Temperature Stress: Temperature fluctuations can alter membrane fluidity, potentially affecting the function of membrane proteins like FliR. Additionally, heat or cold shock may trigger broader stress responses that impact flagellar gene expression. Temperature-shift experiments followed by RT-qPCR analysis of fliR mRNA levels can quantify these effects.

Osmotic Stress: Changes in environmental osmolarity affect cell envelope properties and could influence the assembly and function of membrane-embedded structures like the flagellar export apparatus. High salt concentrations or osmotic shock treatments may reveal condition-specific regulation of fliR.

Oxidative Stress: Reactive oxygen species generated under various growth conditions might damage membrane proteins or affect their folding and assembly. The sensitivity of FliR function to oxidative stress could be assessed using hydrogen peroxide or paraquat exposure.

pH Fluctuations: Environmental pH affects membrane potential and proton motive force, which are crucial for flagellar rotation and potentially for the export functions of the apparatus containing FliR. Examining fliR expression and flagellar assembly across a pH range can reveal pH-dependent regulation.

Research approaches to study environmental regulation include:

  • Reporter gene fusions (e.g., fliR promoter-lacZ) to monitor transcriptional responses

  • Proteomics to assess FliR protein levels under different conditions

  • Functional assays of flagellar export efficiency in various environments

  • Identification of stress-responsive regulators that modulate fliR expression

Understanding how environmental conditions affect fliR expression and function could provide insights into the adaptive strategies of Caulobacter and the integration of environmental sensing with developmental programs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.