Recombinant Caulobacter crescentus Flagellar FliL protein (fliL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
fliL; CCNA_02141; Flagellar FliL protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Caulobacter crescentus (strain NA1000 / CB15N)
Target Names
fliL
Target Protein Sequence
MAKKPEKEAPAPEGEEGAEGEAPAKKKPPILIIAIAAGVLVLGGGGAAAFFLLKPKPAAE AGEHGEKKEEKKKEKKKEEKGDKKDAEKGAEGAAGTPVIKEGPDGVVFYTLPDIVVNMQT ADGKSTFLKLKLTFELPDEETADELTPNLPRLQDMFQTFLRELRPEDLNGSQGTYQLRVE LLRRVNLVAAPAKVNAVLIEEMLIN
Uniprot No.

Target Background

Function
This protein controls the rotational direction of flagella during chemotaxis.
Database Links
Protein Families
FliL family
Subcellular Location
Cell inner membrane; Single-pass membrane protein. Note=Distributed throughout the cell inner membrane and not just at the poles;.

Q&A

What is the functional role of FliL protein in Caulobacter crescentus?

FliL is a single-transmembrane protein associated with flagellar motor function in bacteria, including Caulobacter crescentus. While direct data specific to C. crescentus FliL is limited in the provided sources, comparative studies with related bacteria indicate that FliL plays a supporting role to the stator in the bacterial flagellar motor (BFM) . The protein appears to be involved in stabilizing stator units, which are critical components for torque generation in the flagellar motor.

In Caulobacter, which undergoes a distinctive dimorphic life cycle alternating between a flagellated swarmer cell and a non-motile stalked cell, flagellar proteins like FliL are particularly important for proper motility during the swarmer phase . The protein likely contributes to the structural integrity and proper functioning of the flagellar motor during this mobile phase of the Caulobacter life cycle.

How does FliL protein interact with other flagellar components?

Research indicates that FliL interacts with the stator units in the bacterial flagellar motor in a specific 1:1 stoichiometric relationship . The periplasmic region of FliL has been shown to be crucial for its polar localization, suggesting this region mediates important interactions with other flagellar components .

What are the structural characteristics of the FliL protein?

FliL is characterized as a single-transmembrane protein with distinct cytoplasmic and periplasmic domains . The periplasmic region is particularly important for its function and localization. While the complete crystal structure of Caulobacter crescentus FliL has not been detailed in the provided sources, comparative analysis with homologous proteins suggests it contains a membrane-spanning domain and functional regions that interact with other flagellar components.

The protein's structure enables it to associate with the stator units in the bacterial flagellar motor while maintaining its own independent diffusion pattern within the membrane . This structural arrangement allows FliL to play its supporting role in flagellar function without being permanently bound to any single component of the motor.

How does the stoichiometry of FliL and stator units affect flagellar motor function?

Single-molecule fluorescent microscopy studies have revealed that the stoichiometry of stator units and FliL protein is 1:1 in a functional motor . This precise relationship suggests that each stator unit requires one FliL protein for optimal function. This stoichiometric relationship may be critical for proper force generation and transmission in the flagellar motor.

When this stoichiometry is disrupted, either through mutations or altered expression levels, flagellar function can be compromised. Research has shown that in the absence of FliL, the turnover time of stator units slightly increases, suggesting that FliL may play a role in stabilizing stator units or facilitating their proper assembly into the motor complex . This finding indicates that while FliL may not be absolutely essential for stator assembly, it optimizes the kinetics of this process, which could be particularly important under specific environmental conditions or stress situations.

What is the relationship between FliL localization and bacterial flagellar motor function?

The periplasmic region of FliL has been identified as crucial for its polar localization in the bacterial cell . This localization pattern is not random but is specifically coordinated with the location of the flagellar motor. Interestingly, plug mutations in stator units have been shown to affect the polar localization of FliL, indicating that the activation state of stator units influences FliL recruitment .

This interdependence suggests a complex regulatory mechanism where both components must be properly positioned and activated for optimal flagellar function. The precise localization of FliL may serve to concentrate these proteins at the flagellar pole, ensuring efficient assembly and function of the motor. In Caulobacter crescentus, which undergoes asymmetric cell division and differential flagellar development between cell types, this controlled localization may be particularly important for proper developmental timing and cell-type-specific functions .

How do post-translational modifications affect FliL protein function?

While the provided sources do not directly address post-translational modifications of FliL in Caulobacter crescentus, research on related flagellar systems suggests that such modifications could be significant. In Caulobacter, several flagellar genes (flmA, flmB, flmC, flmD, flmE, flmF, flmG, and flmH) have been identified as potentially involved in posttranslational modification of flagellins or proteins that interact with flagellin monomers .

Given that FliL interacts with the flagellar motor components, it is reasonable to hypothesize that it may undergo similar regulatory modifications. These could include phosphorylation, glycosylation, or other modifications that might alter its binding affinity, stability, or functional properties. Such modifications could serve as a regulatory mechanism to fine-tune flagellar function in response to environmental conditions or during different stages of the Caulobacter cell cycle.

What are the optimal methods for expressing recombinant Caulobacter crescentus FliL protein?

The PurePro Caulobacter Expression System represents an effective approach for expressing recombinant proteins in Caulobacter crescentus . This system utilizes TOPO Cloning technology for rapid cloning of PCR products into an expression vector. For FliL protein expression, the following methodological approach is recommended:

  • Design PCR primers to clone the fliL gene in frame with the CX leader and C-terminal truncated RsaA ORF in the pCX-TOPO vector .

  • Produce PCR products using Taq polymerase to maintain the requisite A-overhangs for TOPO cloning .

  • TOPO Clone the insert into pCX-TOPO and transform into E. coli (e.g., One Shot TOP10F'), then select transformants on LB agar plates containing chloramphenicol (15 μg/ml) .

  • Verify correct insertion and orientation through restriction enzyme digestion and sequencing to confirm in-frame cloning .

  • Transform the verified construct into Caulobacter cells (e.g., One Shot B5 BAC ElectrocompTM) and select on PYE agar plates with chloramphenicol (2 μg/ml) at 30°C .

  • Perform small-scale pilot expression before scaling up for larger protein yields .

This methodological approach leverages Caulobacter's natural secretion machinery, potentially allowing the recombinant FliL protein to be secreted into the culture medium and purified through filtration methods.

What techniques are most effective for studying FliL localization and dynamics?

Based on research approaches described in the literature, single-molecule fluorescent microscopy represents one of the most effective techniques for studying FliL localization and dynamics . This methodology allows researchers to:

  • Directly visualize the spatial distribution of fluorescently tagged FliL proteins within live bacterial cells.

  • Track the movement and diffusion patterns of individual FliL molecules in real-time.

  • Quantify the stoichiometry of FliL and interacting partners through molecular counting by photobleaching techniques .

  • Measure protein turnover rates and residence times at specific cellular locations.

The technique has successfully demonstrated that the periplasmic region of FliL is crucial for its polar localization and that plug mutations in stator units affect this localization . Additionally, single-molecule approaches have revealed that the diffusion patterns of FliL and stator units are independent, with FliL showing unexpectedly slow diffusion rates in the absence of stator units .

What purification strategies yield the highest purity of recombinant FliL protein?

For the purification of recombinant FliL protein expressed in Caulobacter crescentus, a combination of methods can be employed to achieve high purity:

Table 1: Comparative Purification Strategies for Recombinant FliL Protein

Purification MethodPrincipleAdvantagesLimitationsExpected Purity
FiltrationSize-based separationSimple, rapid, maintains native structureLimited resolution~90%
Affinity ChromatographySpecific binding of tagged proteinsHigh specificity, single-step purificationRequires protein tagging>95%
Ion ExchangeCharge-based separationGood for charged proteins, scalablepH-dependent efficiency85-95%
Size ExclusionSeparation by molecular sizeGood for final polishing, native conditionsLow capacity, dilution90-98%

When using the PurePro Caulobacter Expression System, the recombinant protein can be purified to approximately 90% purity by a simple filtration step if expressed as an RsaA fusion protein . For higher purity, a multi-step approach combining filtration with chromatographic methods may be necessary, particularly for applications requiring exceptionally pure protein preparations.

How can researchers distinguish between functional and non-functional recombinant FliL protein?

Distinguishing between functional and non-functional recombinant FliL protein requires multiple analytical approaches:

  • Functional Assays: Measuring flagellar motor function in FliL-deficient strains complemented with the recombinant protein. Functional FliL should restore normal motor behavior and bacterial motility.

  • Localization Analysis: Using fluorescence microscopy to verify proper polar localization of the recombinant FliL. As the periplasmic region is crucial for localization , properly folded and functional FliL should show the expected polar distribution pattern.

  • Interaction Studies: Co-immunoprecipitation or pull-down assays to verify proper interaction with stator units. Functional FliL should maintain the expected 1:1 stoichiometry with stator units in a properly assembled motor .

  • Structural Integrity: Circular dichroism or limited proteolysis can assess whether the recombinant protein maintains its native structural features, which are essential for function.

  • Turnover Rate Analysis: Measuring the effect of the recombinant FliL on stator unit turnover rates. Functional FliL should slightly decrease the turnover time of stator units compared to FliL-deficient conditions .

What are common challenges in studying FliL-stator interactions, and how can they be overcome?

Studying FliL-stator interactions presents several challenges that can be addressed through specific methodological approaches:

  • Challenge: The transient nature of FliL-stator interactions.
    Solution: Utilize cross-linking approaches combined with mass spectrometry to capture and identify interaction interfaces. Chemical cross-linkers with various spacer arm lengths can help map the proximity of different protein regions.

  • Challenge: Distinguishing direct from indirect interactions in the complex flagellar motor environment.
    Solution: Employ in vitro reconstitution systems with purified components to verify direct interactions without cellular confounding factors.

  • Challenge: The membrane-embedded nature of both FliL and stator complexes complicates traditional interaction assays.
    Solution: Use detergent-solubilized proteins or nanodiscs to maintain the native membrane environment while enabling biochemical analysis.

  • Challenge: Limited signal-to-noise ratio in fluorescence measurements due to the small number of FliL molecules per cell.
    Solution: Implement super-resolution microscopy techniques and signal enhancement approaches, such as HaloTag or SNAP-tag labeling with bright synthetic fluorophores.

  • Challenge: Differential behavior of FliL under various physiological conditions.
    Solution: Systematically vary experimental conditions (pH, ionic strength, nutrient availability) to map the complete interaction landscape under different physiological states.

How should researchers interpret contradictory data regarding FliL function across different bacterial species?

When encountering contradictory data regarding FliL function across different bacterial species, researchers should consider several factors:

  • Evolutionary Divergence: Despite sequence homology, FliL proteins may have evolved species-specific functions. Construct phylogenetic trees of FliL proteins to identify potential functional divergence points.

  • Contextual Dependencies: FliL function may depend on the presence of species-specific interaction partners. Comparing the genomic context of fliL genes across species can reveal potential co-evolved functional partners.

  • Methodological Differences: Variations in experimental approaches may account for apparent contradictions. Standardize key methodologies when making cross-species comparisons.

  • Environmental Adaptations: Different bacterial species inhabit diverse ecological niches, potentially leading to functional adaptations in flagellar components. Consider the native environment of each species when interpreting functional differences.

  • Compensatory Mechanisms: Some species may have evolved redundant or compensatory mechanisms that mask FliL phenotypes under standard laboratory conditions. Test function under various stress conditions to reveal cryptic phenotypes.

When specifically comparing Caulobacter crescentus FliL with homologs from other species, the unique dimorphic lifecycle of Caulobacter should be considered as a potential factor influencing FliL function in a species-specific manner.

What are promising approaches for elucidating the complete structure-function relationship of FliL?

Several promising approaches could advance our understanding of the structure-function relationship of FliL:

  • Cryo-electron microscopy of intact flagellar motors with FliL in situ could reveal the precise structural arrangement of FliL relative to other motor components, particularly the stator units with which it maintains a 1:1 stoichiometric relationship .

  • Systematic mutagenesis focusing particularly on the periplasmic region that has been identified as crucial for proper localization . A comprehensive alanine-scanning approach combined with functional assays could map the specific residues essential for different aspects of FliL function.

  • Cross-species complementation studies could identify conserved and divergent functional domains by determining which regions of FliL from different bacterial species can functionally substitute for Caulobacter crescentus FliL.

  • Molecular dynamics simulations based on structural data could provide insights into the conformational changes and dynamics of FliL during flagellar motor function, particularly focusing on how it might respond to mechanical stress or changes in membrane potential.

  • Integrative structural biology approaches combining X-ray crystallography, NMR spectroscopy, and computational modeling could work toward solving the complete three-dimensional structure of FliL, which remains inadequately characterized.

How might understanding FliL function contribute to broader questions in bacterial motility research?

Understanding FliL function has significant implications for several broader questions in bacterial motility research:

  • Energy transduction mechanisms in biological motors could be better understood by elucidating how FliL contributes to stator function, potentially revealing principles of mechanical force generation at the molecular level.

  • Evolutionary adaptation of bacterial motility could be better understood by comparing FliL function across species adapted to different environments, potentially revealing how flagellar motors have been optimized for specific ecological niches.

  • Coordination between motility and cell cycle in Caulobacter crescentus, which undergoes a complex developmental cycle involving differential flagellation , could be further elucidated by understanding how FliL expression and function are regulated during this process.

  • Bacterial response to mechanical stress may involve FliL, as suggested by its supporting role to stator units . This could reveal mechanisms by which bacteria sense and respond to physical forces in their environment.

  • Design principles for synthetic molecular motors could be informed by a detailed understanding of the structure-function relationship of flagellar components like FliL, potentially contributing to the field of bionanotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.