Recombinant Caulobacter crescentus Glucans biosynthesis glucosyltransferase H (opgH)

Shipped with Ice Packs
In Stock

Description

Biological Role of OpgH in Caulobacter crescentus

OpgH is essential for viability and morphogenesis in C. crescentus:

  • OPG Synthesis: Produces cyclic osmoregulated periplasmic glucans (OPGs) that fill the periplasmic space, stabilizing the cell envelope under osmotic stress .

  • Morphogenesis Regulation: Depletion causes asymmetric cell bulging, mislocalization of cell wall synthesis machinery (e.g., MreB, FtsZ), and eventual lysis .

  • Enzymatic Activity: A conserved D-A-D motif (residues 245–247) coordinates UDP-glucose binding and catalysis. Catalytically inactive mutants fail to rescue cell morphology .

Essentiality and Morphological Defects

  • OpgH depletion in C. crescentus leads to:

    • Cell elongation and asymmetric bulging within 3–7 hours .

    • Reduced peptidoglycan synthesis and disrupted divisome/elongasome localization .

    • Lysis under both low- and high-osmolarity conditions .

  • Overactivation of the CenKR two-component system (involved in envelope stress response) mimics OpgH depletion phenotypes, suggesting regulatory crosstalk .

Enzymatic Mechanism

  • Converts UDP-glucose to β-1,2-linked glucans, with a 2–3x increase in UDP-glucose levels observed during OpgH depletion .

  • Structural studies propose a GT-A family glycosyltransferase fold with a long proton transfer pathway critical for catalysis .

Comparative Analysis

  • Unlike E. coli OpgH (non-essential), C. crescentus OpgH is indispensable, highlighting species-specific roles .

  • Functional convergence with Bacillus subtilis UgtP in cell size regulation, though mechanisms differ .

Applications and Implications

  • Antibiotic Development: OpgH’s essential role in envelope integrity positions it as a potential target for novel antibiotics .

  • Biochemical Research: Recombinant OpgH is used to study OPG biosynthesis and its interplay with cell envelope stress pathways .

  • Industrial Relevance: Understanding OPG synthesis aids in engineering osmotolerant bacterial strains .

Research Limitations and Future Directions

  • Unresolved Questions:

    • Direct evidence of OPG production by purified OpgH remains elusive .

    • Structural dynamics of OpgH during glucan polymerization require further elucidation .

  • Ongoing Studies:

    • Investigating OpgH’s interaction with periplasmic hydrolases (e.g., EstG, BglX) .

    • Developing OpgH inhibitors through high-throughput screening .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will strive to fulfill your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
opgH; CC_2018; Glucans biosynthesis glucosyltransferase H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-663
Protein Length
full length protein
Species
Caulobacter crescentus (strain ATCC 19089 / CB15)
Target Names
opgH
Target Protein Sequence
MSDRSSLFDVRSSTSVTLDQVVRRDTVEIPDEAALAMPVQPLSFWQGGARRATALTQDMN LRRWMLGLMTIAMGVAGWKASFDTIALGGVTRLEAVVLTLLAPLFLALSLWFCTALIGFV VLMGRPKDPLGIDSEAPMPKLHTRTAILMPVYNEDAAAVFARLRAMDASIAETGSARNFD IFVISDTRDAQVALAEQACFARFRREANCNVYYRIRKENTGRKAGNVADWVSRWGSAYEH MLVLDADSLMTGEAMVRLADAMERHPGAGLIQTMPMIINGQTIFARTLQFATRLYGRVAW TGLAWWSGSESSFWGHNAIVRTRAFAETCGLPHLPGPKPFGGEVMSHDALESALLRRGGW SVHLAPYLDGSYEESPSNLLDFATRDRRWCRGNIQHVPLIALPGLHWMSRMHLVIGVLSY ALSPLWFFCLSAGLISRALMPELKKAAFTMADLKAAAHALIDWSEIQATAWAMIITFVLL FGPKILGAILVLARKGEVKGFGGKRRMAAGLGVEMLLSALVAPMLMFTQTRAIVEILAGK VGGWAAQRRDADKVDFKEAWAAMGWISLSGLILAASFWFTPDLLTATAPILAGLVLAVPL TMLGAHKVAGLKLKANGLFMTPEERRPPAIVRAAVGAACEPPIRWFARNGRPIGPTTKIR DAA
Uniprot No.

Target Background

Function
Glucans biosynthesis glucosyltransferase H (opgH) plays a crucial role in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Database Links

KEGG: ccr:CC_2018

STRING: 190650.CC_2018

Protein Families
Glycosyltransferase 2 family, OpgH subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is OpgH and what is its primary function in Caulobacter crescentus?

OpgH (Glucans biosynthesis glucosyltransferase H) is an essential enzyme in Caulobacter crescentus that functions as a synthase of osmoregulated periplasmic glucans (OPGs). Unlike its homologs in other organisms like E. coli, the OpgH in C. crescentus is essential for cell viability and plays a critical role in maintaining proper cell morphology and envelope integrity . The protein is predicted to be a UDP-sugar lipid-carrier transferase that catalyzes key steps in polysaccharide biosynthesis . The enzyme's primary function involves converting UDP-glucose to OPGs, as supported by metabolic studies showing 2-3 fold increases in UDP-glucose levels when OpgH is depleted .

What is the genomic context of OpgH in Caulobacter crescentus?

OpgH in Caulobacter crescentus is encoded by the gene opgH (CCNA_02097). Interestingly, unlike E. coli which encodes additional opg genes such as opgG and opgD for OPG modification, C. crescentus appears to have only the opgH homolog . This genetic singularity suggests that OpgH may have evolved additional or specialized functions in Caulobacter compared to its homologs in other bacterial species. The gene is annotated as essential, which is a significant departure from characterized opgH homologs in other organisms where they are typically non-essential .

What are the recommended protocols for OpgH depletion studies in Caulobacter crescentus?

For OpgH depletion studies, researchers typically employ conditional expression systems due to the essential nature of the gene. A recommended approach involves:

  • Construction of a depletion strain: Replace the native opgH gene with a copy under control of an inducible promoter (such as xylose-inducible promoter).

  • Depletion protocol:

    • Grow cells in the presence of inducer (e.g., xylose) to allow expression

    • Wash cells and transfer to media without inducer

    • Monitor phenotypic changes over time (typically 5 hours is sufficient to observe morphological defects)

  • Controls: Include wild-type strains grown under identical conditions to ensure observed phenotypes are specifically due to OpgH depletion.

The success of depletion can be verified through Western blotting to confirm protein depletion, and microscopy to observe the characteristic asymmetric bulging phenotype .

How can I express and purify recombinant OpgH for in vitro studies?

For recombinant expression and purification of OpgH:

  • Expression system: Due to the transmembrane nature of OpgH, E. coli expression systems with specialized capabilities for membrane protein expression (such as C41/C43 strains) are recommended.

  • Purification approach:

    • Express the protein with an affinity tag (His-tag is commonly used)

    • Solubilize membrane fractions using appropriate detergents

    • Purify using affinity chromatography

    • Consider size exclusion chromatography as a polishing step

  • Storage conditions: Store purified OpgH in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage. Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week .

  • Activity preservation: Include appropriate cofactors and stabilizing agents in the buffer to maintain enzymatic activity.

For researchers who do not wish to perform the expression and purification themselves, recombinant OpgH protein is commercially available .

What methods are used to assess OpgH enzymatic activity in vitro?

  • Substrate utilization assay: Monitor the consumption of UDP-glucose using coupled enzymatic assays or HPLC methods.

  • Metabolite profiling: Extract and quantify polar metabolites and measure UDP-glucose levels using LC-MS/MS. An increase in UDP-glucose levels (2-3 fold) when OpgH is depleted provides indirect evidence of enzymatic activity .

  • Catalytically dead mutant comparison: Generate OpgH variants with mutations in conserved glycosyltransferase motifs and compare their activities to wild-type OpgH as a control .

It's worth noting that despite extensive studies, OpgH activity has not been successfully reconstituted with purified protein in vitro from any organism, presenting an opportunity for methodological innovation in this area .

How does OpgH contribute to Caulobacter crescentus cell morphology maintenance?

OpgH plays a critical and previously undiscovered role in C. crescentus morphogenesis. The connection between OpgH and cell morphology involves several mechanisms:

  • Regulation of cell wall synthesis: OpgH depletion causes misregulation of peptidoglycan insertion, particularly affecting the stalk-proximal region of the cell .

  • Morphogenetic complex localization: Loss of OpgH disrupts proper localization of both divisome and elongasome complexes, critical for cell division and elongation respectively .

  • Cell envelope stress response: OpgH appears to be integrated with the CenKR two-component system involved in cell envelope stress homeostasis. Overactivation of CenKR phenocopies OpgH depletion effects .

  • Protein level regulation: OpgH depletion leads to increased levels of the elongasome protein MreB and decreased levels of divisome proteins FtsZ and MipZ .

The essential nature of these functions explains why OpgH is required for viability in Caulobacter, unlike its homologs in other bacterial species.

What is the relationship between OpgH enzymatic activity and its role in cell morphology?

Research has established a direct link between OpgH's glycosyltransferase activity and its role in maintaining cell morphology:

  • Catalytic domain requirement: Mutational studies using a catalytically dead OpgH variant (with disrupted glycosyltransferase motif) show that this variant phenocopies the depletion strain, producing the characteristic asymmetric bulging and morphological defects .

  • Metabolic evidence: OpgH depletion causes UDP-glucose levels to increase 2-3 fold, suggesting that the conversion of this substrate is directly linked to morphological maintenance .

  • Proposed mechanism: The data support a model where OPGs produced by OpgH have both direct effects on cell envelope properties and indirect effects via signaling pathways that regulate morphogenesis.

This relationship provides a novel connection between osmoregulated periplasmic glucan production and cell morphology that was previously unrecognized in bacterial systems.

How does the role of OpgH in Caulobacter differ from OpgH homologs in other bacteria?

The role of OpgH in Caulobacter represents a significant evolutionary divergence from its homologs in other bacteria:

FeatureCaulobacter OpgHOther Bacterial OpgH Homologs
EssentialityEssential for viabilityTypically non-essential
Genetic contextSingle opg gene (opgH)Often part of operon with multiple opg genes
Primary phenotype of lossSevere morphological defects and cell lysisPrimarily osmoprotection defects
Connection to morphogenesisDirect and essential roleNo reported direct connection
Associated stress responsesLinked to CenKR systemVarious organism-specific stress responses

The essential nature of Caulobacter OpgH provides unique research opportunities, as noted by researchers: "The previously studied OpgH homologs have all been nonessential, which limits the questions that we can ask... this provides an appealing possibility for future work on Caulobacter OpgH" .

What are the morphological consequences of OpgH depletion in Caulobacter crescentus?

OpgH depletion results in distinctive and severe morphological aberrations:

  • Asymmetric bulging: Cells develop pronounced bulges specifically in the stalk-proximal region .

  • Cell elongation: Prior to bulging, cells become elongated compared to wild-type cells .

  • Progression to lysis: The bulging phenotype ultimately leads to cell lysis, explaining the essential nature of OpgH .

These morphological defects are consistent across different growth media conditions (both defined M2G medium and complex PYE medium), indicating that the role of OpgH in morphogenesis is fundamental rather than condition-specific .

How can I analyze peptidoglycan synthesis patterns in OpgH-depleted cells?

To analyze peptidoglycan (PG) synthesis patterns in OpgH-depleted cells, researchers can employ the following approaches:

  • PG labeling probes: Use fluorescent D-amino acid derivatives (FDAAs) that incorporate into newly synthesized peptidoglycan. This approach has revealed that OpgH depletion results in misregulation of PG insertion .

  • Pulse-chase experiments: Apply short pulses of labeled D-amino acids followed by chases with unlabeled compounds to track the dynamics of PG insertion over time.

  • Super-resolution microscopy: Employ techniques such as STORM or PALM to visualize the nanoscale organization of the cell wall and identify specific regions of altered synthesis.

  • Muropeptide analysis: Isolate and analyze the composition of peptidoglycan using HPLC to identify changes in crosslinking or other structural features.

These methods can reveal the spatial and temporal disruption of cell wall synthesis that occurs when OpgH function is compromised.

What genetic suppressor strategies can alleviate OpgH depletion phenotypes?

Several genetic approaches can be employed to identify suppressors or modulators of OpgH depletion phenotypes:

  • Transposon mutagenesis screens: Researchers have successfully used suppressor screens to identify genetic factors that can alleviate the lethality of cell envelope stresses in OpgH-related pathways .

  • CenKR pathway manipulation: Since overactivation of the CenKR two-component system phenocopies OpgH depletion, manipulating components of this pathway may identify suppressors .

  • OpgH variant complementation: Complementation with engineered OpgH variants can identify functional domains important for morphogenesis versus other functions.

  • OPG pathway engineering: Introducing alternative pathways for OPG synthesis or modification might compensate for OpgH deficiency.

Researchers have noted: "We have already identified functional OpgH mutants that suppress the lethality of cell envelope stresses in a hypersensitive mutant. These mutants, as well as extragenic mutations isolated from suppressor screens, will be valuable in elucidating the mechanistic role of OpgH and OPGs in cell envelope homeostasis" .

How can cryo-electron microscopy be applied to study OpgH's impact on cell envelope architecture?

Cryo-electron microscopy (cryo-EM) offers powerful approaches to investigate OpgH's role in cell envelope architecture:

  • Cryo-electron tomography (cryo-ET): This technique can visualize the 3D architecture of the cell envelope during OpgH depletion or with catalytically dead OpgH variants. The asymmetric bulges could be examined at nanometer resolution to identify specific structural changes in the peptidoglycan layer, membrane organization, and periplasmic space.

  • Subtomogram averaging: For studying OpgH complexes within the membrane, this approach can reveal the structural organization of OpgH in relation to other morphogenetic proteins.

  • Correlative light and electron microscopy (CLEM): Combining fluorescence microscopy with cryo-EM could track the localization of morphogenetic complexes (using fluorescent tags) and correlate their positions with ultrastructural changes in the cell envelope.

  • In situ structural studies: Emerging techniques for in situ structure determination could potentially reveal the native structure of OpgH within the bacterial membrane, providing insights into its functional interactions.

These approaches would address a key knowledge gap in understanding how OPGs physically contribute to cell envelope integrity and morphology maintenance.

What systems biology approaches can reveal the regulatory networks connecting OpgH to cell division machinery?

Integrative systems biology approaches can elucidate the regulatory networks connecting OpgH function to cell division:

  • Transcriptomics: RNA-seq analysis comparing wild-type, OpgH-depleted, and catalytically dead OpgH mutant cells can identify differentially expressed genes involved in cell division, cell wall synthesis, and stress responses.

  • Proteomics: Quantitative proteomics can track changes in the levels of divisome proteins (FtsZ, MipZ) and elongasome proteins (MreB) that are altered during OpgH depletion .

  • Phosphoproteomics: This approach can identify signaling cascades activated in response to OpgH depletion, particularly focusing on two-component systems like CenKR.

  • Metabolomics: Comprehensive metabolite profiling beyond UDP-glucose could identify additional metabolic changes associated with OpgH function.

  • Network modeling: Integrating these multi-omics datasets can generate predictive models of the regulatory networks connecting OPG metabolism to cell division and morphogenesis.

These approaches would help address the observation that "OPG depletion activates CenKR, leading to changes in the expression of cell envelope-related genes, but that OPGs also exert CenKR-independent effects on morphogenesis" .

What are the implications of OpgH research for understanding bacterial cell envelope stress responses?

OpgH research has broader implications for understanding bacterial envelope stress responses:

  • Novel stress response pathways: The essential nature of OpgH in Caulobacter reveals a previously unappreciated connection between OPG synthesis and fundamental aspects of cell envelope integrity maintenance.

  • α-proteobacteria-specific mechanisms: The connection between OpgH and the CenKR two-component system suggests α-proteobacteria may have evolved distinctive envelope stress response mechanisms .

  • Evolutionary adaptation: The essentiality of OpgH in Caulobacter but not in other bacteria suggests evolutionary adaptations in envelope stress responses across bacterial lineages.

  • Potential antimicrobial targets: The essential role of OpgH in Caulobacter suggests that targeting OPG synthesis pathways could be a viable strategy for developing antimicrobials against related pathogens.

  • Model for studying essential glycosyltransferases: Caulobacter OpgH provides a unique model system where "the essentiality of Caulobacter OpgH and morphological defects associated with its loss provide an opportunity to elucidate the mechanism of action of OpgH and the OPG biosynthesis pathway" .

Future research in this area will likely lead to fundamental new insights into the interconnections between bacterial metabolism, cell envelope homeostasis, and morphogenesis regulation.

What are the most significant unanswered questions about OpgH function in Caulobacter?

Despite significant progress, several fundamental questions about OpgH remain unanswered:

  • Biochemical characterization: The specific OPG structures synthesized by Caulobacter OpgH have not been fully characterized, and the enzyme has not been reconstituted with purified protein in vitro .

  • Mechanistic link to morphogenesis: The precise mechanism by which OPGs influence cell morphology remains to be elucidated - whether through direct physical effects on the cell envelope or through signaling pathways.

  • Evolutionary significance: Why OpgH evolved to be essential in Caulobacter but not in other bacteria remains an open question that may reveal important insights into bacterial cell biology.

  • Domain-specific functions: The specific roles of different OpgH domains in its various functions (OPG synthesis, morphogenesis, stress response) have not been fully mapped.

  • Interaction partners: The complete set of proteins that interact with OpgH to coordinate its functions with other cellular processes remains to be identified.

Addressing these questions would significantly advance our understanding of bacterial cell envelope biology and the diverse functions of glycosyltransferases in bacterial physiology.

How might structural biology approaches advance our understanding of OpgH function?

Structural biology approaches offer promising avenues to advance OpgH research:

  • Full-length structure determination: While challenging due to the membrane-embedded nature of OpgH, determining its full structure would provide insights into its catalytic mechanism and how it might interact with other cellular components.

  • Substrate-bound structures: Capturing OpgH structures with bound substrates (UDP-glucose) or transition state analogs would elucidate the catalytic mechanism and potentially enable rational design of inhibitors.

  • Domain-specific analyses: Structural studies of isolated domains could reveal functional modules and how they coordinate different aspects of OpgH function.

  • Comparative structural biology: Comparing structures of Caulobacter OpgH with non-essential homologs could reveal adaptations that explain its essential nature in Caulobacter.

  • Structure-guided mutagenesis: Using structural information to design targeted mutations could help dissect specific functions and identify key residues for different activities.

As noted by researchers studying OpgH: "This provides an appealing possibility for future work on Caulobacter OpgH, including avenues such as a mutagenesis screen to isolate novel mutants or a larger scale functional domain analysis study" .

What are the potential biotechnological applications of research on bacterial glucosyltransferases like OpgH?

Research on OpgH and related bacterial glucosyltransferases offers several biotechnological opportunities:

  • Antimicrobial development: The essential nature of OpgH in Caulobacter suggests that targeting similar glycosyltransferases could be a strategy for developing novel antimicrobials against related pathogenic α-proteobacteria.

  • Biopolymer engineering: Understanding the enzymatic mechanism of OpgH could enable engineering of novel glycan structures with applications in biomaterials and drug delivery.

  • Cell factory optimization: Insights into how OpgH affects cell envelope integrity could inform strategies to improve bacterial cell factories for biotechnological production.

  • Biosensors: OpgH-based systems could potentially be developed as biosensors for cell envelope stress or for screening compounds that affect cell wall synthesis.

  • Synthetic biology tools: The relationship between OpgH and cell morphology could be exploited to develop tools for controlling bacterial cell shape in synthetic biology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.