Recombinant Caulobacter crescentus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mscL; CCNA_03700; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Caulobacter crescentus (strain NA1000 / CB15N)
Target Names
mscL
Target Protein Sequence
MSVVKEFREFIARGNVIDLAVGVIIGAAFNGIVKSLVDQVIMPPIGLLTGGLDFSKLEWV LRPEDPASEAIEKVAIQYGAFVNTVIQFFIVATVVFLLVKLVNEIRRQDAAEPAPAAPPA PTAEETLLTEIRDLLAKKG
Uniprot No.

Target Background

Function
A mechanosensitive ion channel that opens in response to membrane stretch. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Caulobacter crescentus and why is it useful for recombinant protein expression?

Caulobacter crescentus is a Gram-negative, freshwater bacterium known for its distinctive asymmetric cell division and dimorphic lifestyle. It divides into a stalked cell that immediately enters S phase and a swarmer cell that remains in G1 phase until differentiation . This bacterium offers several advantages for recombinant protein expression:

  • Well-characterized genome and cell cycle regulation

  • Crystalline surface layer (S-layer) protein that enables high-density display of heterologous proteins

  • Non-pathogenic nature making it suitable for laboratory work

  • Ability to grow on various carbon sources (glucose, xylose, mannose) with different growth rates:

Carbon SourceSpecific Growth Rate (h⁻¹)
Glucose0.142
Xylose0.109
Mannose0.053

The optimal pH for C. crescentus growth is around 6.5, with typical cultivation temperatures of 30-33°C .

  • What is the mechanosensitive channel of large conductance (MscL) and what is its bacterial function?

MscL is a membrane protein that forms a mechanosensitive channel responding to stretch forces in the lipid bilayer. According to structural studies, MscL forms a homopentamer with each subunit containing two transmembrane regions . The channel opens via a bilayer mechanism triggered by hydrophobic mismatch and changes in membrane curvature or transbilayer pressure profile .

The primary physiological role of MscL is to protect bacterial cells from osmotic shock. When bacteria experience hypoosmotic shock (sudden decrease in external osmolarity), water rapidly enters the cell, increasing turgor pressure. MscL channels open in response to the resulting membrane tension, allowing the release of small solutes and thereby preventing cell lysis. During stationary phase and osmotic shock conditions, MscL expression is upregulated to enhance this protective function .

  • What methods are used to express and verify recombinant proteins in Caulobacter crescentus?

Several approaches have been developed for expressing recombinant proteins in C. crescentus:

  • S-layer fusion system: The crystalline surface layer protein can be genetically modified to display heterologous proteins at high density. This has been successfully used for HIV microbicide development by displaying proteins like MIP1α and CD4 domain 1 .

  • Plasmid-based expression: Various plasmids have been optimized for C. crescentus, including those used for environmental applications like heavy metal remediation .

  • Cell-cycle regulated expression: The well-characterized cell cycle regulation system of C. crescentus can be harnessed for temporally controlled expression.

Verification methods include:

  • Western immunoblot analysis using protein-specific antibodies

  • Immunofluorescence microscopy to visualize protein localization

  • Functional assays specific to the protein of interest

For MscL specifically, functional verification would typically include osmotic shock survival assays and electrophysiological measurements to confirm channel activity.

  • How does the cell cycle of C. crescentus influence recombinant protein expression?

C. crescentus has a tightly regulated cell cycle with distinct gene expression patterns at different stages . This influences recombinant protein expression in several ways:

  • Gene expression is controlled by cell cycle regulators like CtrA and DnaA

  • Protein synthesis rates vary between swarmer and stalked cells

  • Membrane composition and properties differ between cell types

  • Protein quality control systems function differently across the cell cycle

For effective recombinant expression, researchers should consider:

  • Cell synchronization techniques to obtain homogeneous populations

  • Cell cycle-specific promoters for targeted expression

  • Timing of induction relative to cell cycle progression

  • Different protein inheritance patterns between daughter cells

The multilayered control of chromosome replication in C. crescentus suggests that integration of expression constructs must account for cell cycle regulation to achieve optimal results.

Intermediate Research Questions

  • How can the S-layer protein of C. crescentus be utilized for membrane protein studies?

The S-layer protein (RsaA) of C. crescentus forms a crystalline array covering the cell surface, offering unique opportunities for membrane protein research:

  • Domain display strategy: While complete MscL cannot be displayed on the S-layer due to its membrane integration requirements, specific extracellular domains can be fused to RsaA for structural or interaction studies.

  • Anchoring approach: The S-layer can be engineered with membrane-anchoring domains that position MscL studies at the interface between the S-layer and outer membrane.

  • Co-display systems: Multiple protein domains can be simultaneously displayed, allowing for complex interaction studies relevant to MscL function.

The methodology typically involves:

  • Creating genetic fusions between MscL domains and the RsaA protein

  • Expressing these constructs in S-layer deficient strains

  • Verifying display using immunofluorescence microscopy

  • Functional testing through appropriate binding or activity assays

Research has demonstrated that proteins displayed on the C. crescentus S-layer maintain their functional conformation, as evidenced by antibody recognition and biological activity of displayed HIV-blocking proteins .

  • What techniques are optimal for functional characterization of MscL channels expressed in C. crescentus?

A comprehensive approach to characterizing recombinant MscL in C. crescentus would include:

  • Electrophysiological methods:

    • Patch-clamp analysis of spheroplasts or reconstituted channels

    • Planar lipid bilayer recordings with purified protein

    • Fluorescence-based ion flux assays in vesicles

  • Osmotic challenge assays:

    • Survival rates during hypoosmotic shock

    • Real-time volumetric responses to osmotic gradients

    • Solute release measurements during controlled osmotic downshock

  • Structural analysis:

    • Electron microscopy of purified channels

    • Dynamic light scattering to assess oligomeric state (similar to techniques used for FtsZ )

    • Förster resonance energy transfer (FRET) to monitor conformational changes

  • In vivo imaging:

    • Fluorescently tagged MscL to track localization

    • Single-molecule tracking to monitor channel dynamics

    • Tension-sensitive fluorescent probes to correlate membrane tension with channel activity

Each approach provides complementary information, with electrophysiology offering direct functional insights while imaging techniques provide context about cellular distribution and dynamics.

  • How does the protein quality control network in C. crescentus influence recombinant MscL expression?

The C. crescentus protein quality control (PQC) network significantly impacts recombinant membrane protein expression :

  • Chaperone systems:

    • DnaKJ/E assists proper protein folding

    • ClpB disaggregase resolves protein aggregates during stress

    • These systems are critical for complex membrane proteins like MscL

  • Protease activities:

    • ClpXP is a key proteolytic complex in C. crescentus

    • The SsrA/SspB pathway targets incompletely synthesized proteins

    • Improperly folded MscL may be rapidly degraded by these systems

  • Stress responses:

    • ClpB expression occurs exclusively during stress conditions

    • Heat shock response affects membrane fluidity and protein folding

    • Overexpression stress may trigger protective mechanisms

Research suggests that protein aggregates in C. crescentus are inherited by both daughter cells , which has implications for sustained expression of challenging membrane proteins like MscL.

Strategies to leverage the PQC network include:

  • Co-expression of specific chaperones

  • Temporal control of expression to manage folding load

  • Mild pre-stress treatments to induce protective responses

  • Temperature modulation to optimize folding vs. expression rate

  • What are the advantages and challenges of using C. crescentus versus E. coli for mechanosensitive channel studies?

Comparing these expression systems reveals distinct considerations for MscL research:

AspectCaulobacter crescentusEscherichia coli
Membrane compositionDifferent phospholipid profile; potentially beneficial for certain membrane proteinsWell-characterized; standard for most membrane protein work
Growth characteristicsSlower growth (μmax ≈ 0.142 h⁻¹ on glucose) ; dimorphic cell typesRapid growth (μmax ≈ 0.7 h⁻¹ on glucose); relatively homogeneous
Genetic toolsFewer tools available but increasing; well-established cell cycle regulationExtensive toolbox; numerous expression vectors and strains
Surface displayS-layer provides unique opportunities for surface display Requires specific systems like autotransporters
Cell size and shapeCurved cells with distinct polar regionsRod-shaped cells without pronounced polarity
Native MscL contextNatural environment for C. crescentus MscLNatural environment for E. coli MscL
Stress responsesClpB expressed only during stress More constitutive expression of some stress proteins

Advantages of C. crescentus include:

  • Possibility to study cell cycle-dependent effects

  • S-layer technology for surface engineering

  • Different membrane composition that may better support certain channels

  • Lower background of native mechanosensitive channels

Challenges include:

  • Slower growth and lower biomass yield

  • Fewer commercial tools and protocols

  • More complex cell morphology for certain techniques

  • Less characterized membrane protein expression pathways

Advanced Research Questions

  • How can structural differences between C. crescentus MscL and other bacterial MscL channels be exploited for structural biology?

While the search results don't specifically describe C. crescentus MscL structure, comparative structural biology approaches can provide valuable insights:

  • Evolutionary adaptation analysis:

    • C. crescentus inhabits freshwater environments with different osmotic challenges than enteric bacteria

    • Comparing MscL sequences across bacterial species can identify environment-specific adaptations

    • These differences may reveal critical regions for channel gating and sensitivity

  • Crystallography and cryo-EM opportunities:

    • The M. tuberculosis MscL structure has been solved , providing a template for comparative studies

    • Unique structural features of C. crescentus MscL might facilitate crystal contacts or particle orientation

    • Different detergent stability profiles could be advantageous for structural studies

  • Hybrid structural approaches:

    • Combining data from X-ray crystallography, cryo-EM, and SAXS

    • Integrating computational models with experimental constraints

    • Using crosslinking mass spectrometry to validate structural predictions

  • Methodological considerations:

    • Express C. crescentus MscL with fusion partners that promote crystallization

    • Screen lipidic cubic phase conditions optimized for C. crescentus membrane proteins

    • Implement nanobody or crystallization chaperone approaches for structure determination

Understanding structural differences would provide insights into environment-specific adaptations of mechanosensation and could reveal new principles of channel gating applicable to other systems.

  • What molecular dynamics strategies can best predict MscL behavior in the unique membrane environment of C. crescentus?

Computational approaches can bridge the gap between structural data and functional understanding:

  • Multi-scale membrane modeling:

    • Atomistic simulations of C. crescentus membrane patches

    • Coarse-grained models for longer timescales and larger systems

    • Hybrid models combining different resolution levels

  • Tension-induced gating simulations:

    • Apply lateral membrane tension using constant area or surface tension ensembles

    • Calculate free energy landscapes for the closed-to-open transition

    • Compare gating energetics between different lipid compositions

  • Lipid-protein interaction analysis:

    • Identify specific lipid binding sites on C. crescentus MscL

    • Calculate residence times and binding energies for different lipid types

    • Predict how lipid composition affects channel function

  • Methodological protocol:

    • Build homology model of C. crescentus MscL based on available structures

    • Embed in membrane with C. crescentus-like lipid composition

    • Equilibrate system (>100 ns) prior to applying tension

    • Analyze pore dimensions, subunit interactions, and lipid-protein contacts

    • Validate predictions with experimental approaches

These simulations could reveal unique aspects of C. crescentus MscL gating and guide experimental design for functional studies.

  • How might the asymmetric cell division in C. crescentus be utilized to study MscL inheritance and quality control?

The distinctive asymmetric division of C. crescentus creates unique opportunities for studying membrane protein inheritance:

  • Differential protein partitioning:

    • Track fluorescently labeled MscL distribution during cell division

    • Determine whether MscL channels are equally inherited by stalked and swarmer cells

    • Investigate whether channel age affects distribution patterns

  • Quality control differences:

    • The search results indicate that protein aggregates are shared between stalked and swarmer cells

    • Study whether misfolded MscL channels show different degradation rates in different cell types

    • Investigate the role of cell-type specific proteases in MscL turnover

  • Membrane domain inheritance:

    • Map MscL distribution relative to membrane microdomains

    • Determine whether channels partition specifically during division

    • Correlate channel distribution with functional properties

  • Cell cycle regulation of MscL:

    • Investigate whether MscL expression, degradation, or activity is cell cycle regulated

    • Determine if osmotic shock responses differ between stalked and swarmer cells

    • Study how cell differentiation affects membrane tension sensing

Experimental approach:

  • Create fluorescent protein fusions to track MscL localization

  • Implement cell synchronization to obtain homogeneous populations

  • Use photoactivatable fluorescent proteins to pulse-label channels and track inheritance

  • Correlate microscopy data with functional measurements of channel activity

  • What role might MscL play in the adaptation of C. crescentus to its freshwater environment?

As a freshwater bacterium, C. crescentus faces distinct osmotic challenges compared to enteric bacteria like E. coli:

  • Environmental adaptation:

    • Freshwater environments typically have lower osmolarity than host-associated niches

    • C. crescentus may have evolved specific tension-sensing mechanisms

    • MscL gating properties may be tuned to freshwater osmotic fluctuations

  • Surface attachment considerations:

    • C. crescentus attaches to surfaces via the holdfast at the stalked cell pole

    • Attachment may influence membrane tension distribution

    • MscL could play a role in sensing mechanical forces during attachment

  • Cell cycle integration:

    • Osmotic protection needs may differ between swarmer and stalked cells

    • MscL function could be integrated with cell cycle progression

    • Regulation may be coordinated with other cell cycle events

  • Comparative ecological analysis:

    • Compare MscL properties across bacteria from different osmotic niches

    • Investigate whether freshwater bacteria share common MscL adaptations

    • Determine if C. crescentus MscL has unique functional properties

Experimental approaches:

  • Compare osmotic shock survival between wild-type and MscL-deficient C. crescentus

  • Measure channel activity under conditions mimicking natural freshwater environments

  • Exchange MscL genes between C. crescentus and other bacteria to test functional compatibility

  • Investigate MscL expression patterns during adaptation to different osmotic conditions

Methodological Research Questions

  • What are the optimal purification strategies for obtaining functional C. crescentus MscL for structural and biochemical studies?

A systematic purification protocol would involve:

  • Cell growth optimization:

    • Culture C. crescentus under optimal conditions (pH 6.5, 30-33°C)

    • Consider using defined media with glucose as carbon source for highest growth rate

    • Scale up in bioreactors with controlled aeration and pH

  • Membrane preparation:

    • Harvest cells at mid-logarithmic phase

    • Disrupt cells using a combination of enzymatic and mechanical methods

    • Isolate membranes by differential ultracentrifugation

  • Solubilization screening:

    • Test a panel of detergents at various concentrations:

    DetergentConcentration RangeNotes
    n-Dodecyl-β-D-maltoside (DDM)0.5-2%Commonly used for many membrane proteins
    n-Decyl-β-D-maltoside (DM)0.5-2%Shorter chain alternative to DDM
    Lauryl maltose neopentyl glycol (LMNG)0.01-0.1%Low CMC, good for stability
    Digitonin0.5-1%Mild natural detergent
    SMA copolymer2-3%Detergent-free extraction
  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Size exclusion chromatography to isolate homogeneous channel pentamers

    • Optional ion exchange step for further purification

  • Functional validation:

    • Reconstitute purified MscL into liposomes

    • Perform patch-clamp analysis to confirm channel activity

    • Use fluorescent dye release assays as a high-throughput alternative

Critical considerations include maintaining the pentameric assembly throughout purification and preserving the native lipid environment as much as possible to maintain channel function.

  • How can electrophysiological methods be adapted to study C. crescentus MscL channels?

Electrophysiological characterization of MscL requires specialized approaches:

  • Spheroplast preparation protocol:

    • Grow C. crescentus to mid-log phase in optimal media

    • Harvest and concentrate cells by gentle centrifugation

    • Resuspend in buffer containing 0.5M sucrose, 10mM Tris (pH 7.5), 1.5mM EDTA

    • Add lysozyme (200μg/ml) and incubate at room temperature

    • Monitor spheroplast formation by phase-contrast microscopy

    • Use spheroplasts immediately for patch-clamp recordings

  • Patch-clamp configurations:

    • Excised inside-out patches for precise control of membrane tension

    • Negative pressure application via calibrated pressure clamp

    • High K⁺ solutions to maximize channel conductance

  • Reconstitution systems:

    • Purify C. crescentus MscL and reconstitute into liposomes

    • Form giant unilamellar vesicles (GUVs) for patch-clamp studies

    • Use planar lipid bilayers for single channel recordings

  • Data analysis considerations:

    • Measure pressure thresholds for channel activation

    • Determine single-channel conductance and subconductance states

    • Analyze channel kinetics (open probability, dwell times)

    • Compare results with well-characterized MscL channels from other bacteria

Technical challenges include:

  • The small size of C. crescentus cells making direct patching difficult

  • The presence of the S-layer potentially interfering with gigaseal formation

  • Maintaining membrane protein stability during purification and reconstitution

  • What high-throughput screening approaches can identify conditions that optimize MscL expression and function in C. crescentus?

Systematic screening can accelerate optimization of recombinant MscL expression:

  • Expression condition matrix:

    • Vary key parameters in factorial design:

      • Temperature (25-37°C)

      • pH (6.0-7.5)

      • Carbon source (glucose, xylose, mannose)

      • Induction timing relative to growth phase

      • Media composition (minimal vs. complex)

  • Reporter-based systems:

    • Fluorescent protein fusions to monitor expression levels

    • Split GFP complementation to assess proper folding

    • FRET-based sensors to monitor conformational states

    • Osmotic shock survival as a functional readout

  • Miniaturized assay formats:

    • 96-well growth and expression systems

    • Microfluidic devices for single-cell analysis

    • Automated imaging platforms for high-content screening

  • Data analysis workflow:

    • Multivariate statistical analysis to identify optimal conditions

    • Machine learning algorithms to predict expression outcomes

    • Response surface methodology to optimize multiple parameters

Implementation strategy:

  • Design initial screening with widely spaced parameter combinations

  • Identify promising regions of parameter space

  • Perform focused screens around optimal conditions

  • Validate top conditions at larger scale

  • Correlate expression levels with functional activity

  • How can lipidomic and membrane biophysical approaches inform the functional study of MscL in C. crescentus?

The lipid environment is critical for MscL function, making membrane characterization essential:

  • Comprehensive lipidome analysis:

    • Extract total lipids from C. crescentus membranes

    • Perform liquid chromatography-mass spectrometry (LC-MS/MS)

    • Identify and quantify phospholipid species, fatty acids, and other membrane components

    • Compare lipid profiles between different cell types and growth conditions

  • Membrane physical properties:

    • Measure membrane fluidity using fluorescence anisotropy

    • Determine lateral pressure profiles through molecular dynamics simulations

    • Map membrane thickness and mechanical properties using atomic force microscopy

    • Measure membrane tension tolerance using micropipette aspiration of giant vesicles

  • Structure-function correlations:

    • Reconstitute MscL in liposomes with systematically varied lipid compositions

    • Measure channel activity as a function of specific lipid parameters:

      • Acyl chain length and saturation

      • Headgroup composition

      • Membrane thickness

      • Lateral pressure profile

  • Methodological workflow:

    • Culture C. crescentus under defined conditions

    • Isolate membrane fractions with high purity

    • Perform parallel lipidomic and functional analyses

    • Develop predictive models relating membrane composition to channel function

    • Test predictions by engineering membranes with specific properties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.