Recombinant Caulobacter crescentus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Caulobacter crescentus Lipoprotein Signal Peptidase

Lipoprotein signal peptidase (lspA) is an aspartyl protease responsible for cleaving the transmembrane helix signal peptide of lipoproteins as part of the essential lipoprotein-processing pathway in bacteria . In Caulobacter crescentus, a Gram-negative bacterium known for its asymmetric cell division and dimorphic life cycle, this enzyme plays a crucial role in bacterial membrane integrity and function. The recombinant form of C. crescentus lspA has been developed to facilitate research into bacterial lipoprotein processing mechanisms and to explore potential therapeutic applications.

The significance of lspA extends beyond its fundamental role in C. crescentus physiology. Members of this enzyme family are considered excellent targets for antibiotic development because they are essential in Gram-negative bacteria, important for virulence in Gram-positive bacteria, and may have a reduced likelihood of developing antibiotic resistance . The availability of recombinant C. crescentus lspA has enabled detailed structural and functional studies that illuminate the working mechanisms of this important bacterial enzyme.

Catalytic Activity in Lipoprotein Processing

Lipoprotein signal peptidase functions as a critical component in the bacterial lipoprotein processing pathway. The enzyme specifically cleaves the signal peptide from prolipoproteins after they have been modified by the addition of diacylglycerol by prolipoprotein diacylglyceryl transferase (Lgt) . This processing step is essential for the proper localization and function of bacterial lipoproteins, which play diverse roles in cell envelope integrity, nutrient acquisition, and virulence.

The catalytic mechanism of LspA involves a pair of aspartic acid residues (the catalytic dyad) that coordinate the proteolytic cleavage of the signal peptide . The enzyme's active site is located at the interface between the membrane and periplasmic space, allowing it to access the cleavage site of membrane-anchored prolipoproteins.

Conformational States and Substrate Interaction

Research has revealed that LspA proteins function through a dynamic equilibrium between at least three conformational states: closed, intermediate, and open . Each of these states plays a specific role in the enzyme's catalytic cycle:

  1. The closed conformation shields the charged and polar active site residues from the hydrophobic membrane environment when no substrate is present.

  2. The intermediate conformation is associated with antibiotic binding and may represent a state involved in substrate recognition.

  3. The open conformation creates a trigonal cavity that can accommodate the lipoprotein substrate, allowing the signal peptide and diacylglyceryl moiety to bind in the correct orientation for cleavage .

This conformational flexibility enables LspA to recognize and process a diverse array of bacterial lipoproteins, explaining how a single enzyme can cleave signal peptides from numerous different substrates within the bacterial cell.

Potential as an Antibiotic Target

One of the most promising applications of research on recombinant C. crescentus lspA is in the development of novel antibiotics. LspA proteins have several characteristics that make them attractive targets for antimicrobial development:

  1. They are essential in Gram-negative bacteria, making them critical vulnerability points in these organisms.

  2. They play important roles in virulence in Gram-positive bacteria, suggesting that inhibitors could reduce pathogenicity even in non-lethal doses.

  3. The highly conserved nature of the active site suggests that resistance mutations affecting inhibitor binding would likely also impair the enzyme's natural function, potentially reducing the emergence of resistance .

Several antibiotics, including globomycin and myxovirescin, have been identified as inhibitors of LspA proteins, providing valuable templates for the development of more effective and selective antimicrobial agents . The study of recombinant C. crescentus lspA contributes to this endeavor by providing detailed structural and functional information that can guide inhibitor design and optimization.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please specify them in your order notes. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; CC_0700; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Caulobacter crescentus (strain ATCC 19089 / CB15)
Target Names
lspA
Target Protein Sequence
MPSLSITRQGWIAYAIAAVTVVLDQISKLWILGLLGREPGASLPLLGPIHLTMVHNYGMS FGLLRDSDWGRWLLIGFSILVVIGLAVWVHKATRPLLAVGIGLIIGGAIGNNLIDRVIYG YVVDFIDVSRLYFPWVFNIADSGISVGVALLLLDSFLSEENKLSHQTE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: ccr:CC_0700

STRING: 190650.CC_0700

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of LspA in Caulobacter crescentus?

LspA (Lipoprotein signal peptidase) in C. crescentus functions as a specialized type II signal peptidase that cleaves the signal sequence from prelipoproteins following their diacylglyceryl modification by prolipoprotein diacylglyceryl transferase (Lgt). This cleavage occurs at the conserved cysteine residue within the lipobox motif, resulting in a diacylated apolipoprotein that can be further modified by apolipoprotein N-acyltransferase (Lnt) . Unlike in some other bacteria, these lipoprotein processing pathways appear to be essential in C. crescentus, similar to what has been observed with other proteolytic systems such as ClpXP . The essentiality of these pathways likely reflects the critical roles that mature lipoproteins play in C. crescentus cell envelope integrity, cell cycle progression, and developmental regulation. The processing of lipoproteins by LspA creates functional proteins that participate in various cellular processes including cell division, nutrient acquisition, and stress responses.

How does C. crescentus LspA differ from LspA in other bacterial species?

C. crescentus LspA shares structural similarities with other bacterial type II signal peptidases but exhibits important species-specific characteristics. While the catalytic mechanism involving a serine-lysine dyad is conserved, C. crescentus LspA shows distinct substrate specificity profiles compared to homologs from E. coli or H. pylori . Unlike H. pylori LspA, which appears to be resistant to the antibiotic globomycin, C. crescentus LspA likely maintains sensitivity to this inhibitor, similar to E. coli LspA . Another significant difference lies in the integration of lipoprotein processing with developmental pathways in C. crescentus. In this organism, lipoprotein maturation appears to be coordinated with the cell cycle, potentially through interactions with cell cycle regulators like the ClpXP protease system, which is essential in C. crescentus but dispensable in E. coli . These differences reflect the adaptation of LspA function to the unique cellular architecture and life cycle of C. crescentus.

What is known about the structural characteristics of C. crescentus LspA?

The structural characteristics of C. crescentus LspA can be inferred from comparative analysis with better-characterized homologs. LspA proteins typically contain 4-5 transmembrane domains with a conserved catalytic domain located at the periplasmic interface of the cytoplasmic membrane. The active site contains a serine-lysine dyad critical for catalytic activity, with the serine residue serving as the nucleophile in the peptide bond cleavage reaction. Based on sequence conservation patterns, C. crescentus LspA likely maintains these core structural features while exhibiting unique surface characteristics that influence substrate recognition. The protein is expected to be approximately 18-20 kDa in size with a predominantly hydrophobic composition reflecting its membrane-embedded nature. The topology of the protein places both N and C termini in the cytoplasm, with the active site positioned to access the lipobox of prelipoproteins following their membrane insertion. This structural arrangement facilitates the sequential processing of lipoproteins in coordination with Lgt and Lnt activities.

What expression systems are most effective for producing recombinant C. crescentus LspA?

For the recombinant expression of C. crescentus LspA, several expression systems have proven effective, each with distinct advantages depending on research objectives. E. coli-based expression systems using vectors with tightly controlled promoters (such as pET or pBAD series) are commonly employed due to their high yield and ease of genetic manipulation. When using E. coli as a host, it's critical to consider that membrane proteins like LspA require specialized strains (such as C41/C43(DE3) or Lemo21(DE3)) that are designed to accommodate membrane protein overexpression without toxicity . For complementation studies, plasmid-based expression driven by the native C. crescentus LspA promoter (approximately 500 bp upstream of the coding sequence) can be used, similar to the approach employed for ClpX variants in C. crescentus studies . For high-purity biochemical analysis, fusion constructs incorporating affinity tags (His6, FLAG, or Strep-II) at the C-terminus rather than the N-terminus are recommended to avoid interfering with membrane insertion. Expression temperature optimization is crucial, with induction at lower temperatures (16-20°C) often yielding properly folded protein at higher quantities than standard conditions.

What purification strategies overcome the challenges of membrane protein isolation for C. crescentus LspA?

Purification of recombinant C. crescentus LspA presents significant challenges due to its hydrophobic nature and membrane localization. A systematic approach beginning with careful membrane isolation is essential. Bacterial cells should be disrupted by sonication or French press in a buffer containing protease inhibitors and stabilizing agents such as glycerol (10%) and reducing agents (DTT or β-mercaptoethanol). Membrane fractions are then isolated by differential centrifugation, with the inner membrane containing LspA separated from the outer membrane using detergent fractionation or sucrose gradient centrifugation. For extraction from membranes, mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations slightly above their critical micelle concentration provide optimal solubilization while preserving protein structure and activity. Affinity chromatography using immobilized metal affinity chromatography (IMAC) for His-tagged proteins, followed by size exclusion chromatography, effectively removes contaminating proteins. Throughout purification, it's crucial to maintain detergent concentrations above the critical micelle concentration to prevent protein aggregation. This protocol typically yields protein with >90% purity suitable for biochemical and structural studies, with yields ranging from 0.5-2 mg per liter of culture.

How can activity assays be designed to evaluate C. crescentus LspA function in vitro?

Designing robust activity assays for C. crescentus LspA requires careful consideration of substrate selection, reaction conditions, and detection methods. An effective approach employs synthetic peptide substrates containing the lipobox motif conjugated to fluorogenic groups that produce a measurable signal upon cleavage. Typically, these assays measure activity by monitoring the increase in fluorescence (using substrates like FRET peptides) or changes in chromatographic profiles of substrate/product mixtures. For more physiologically relevant assessments, purified prelipoproteins from C. crescentus can be used as substrates, with cleavage detected by SDS-PAGE mobility shifts or mass spectrometry analysis of reaction products. The reaction buffer should mimic physiological conditions (pH 7.2-7.6, 150 mM NaCl) supplemented with appropriate detergent concentrations to maintain enzyme solubility. Inhibition studies using globomycin provide valuable controls to confirm specific LspA activity. Kinetic parameters (Km, Vmax) can be determined by varying substrate concentrations under standardized conditions. For quantifying absolute activity, calibration curves using synthetic peptide standards corresponding to expected cleavage products should be established. These assays typically detect activity in the nanomolar range of enzyme concentration, with reaction times of 30-60 minutes producing measurable signal changes.

How can C. crescentus LspA be used to study species-specific aspects of bacterial lipoprotein processing?

C. crescentus LspA provides an excellent model for investigating species-specific aspects of bacterial lipoprotein processing, particularly in relation to developmental regulation. Researchers can employ complementation assays similar to those used for ClpX studies, where chimeric constructs containing domains from different bacterial LspA homologs are expressed in conditional C. crescentus lspA mutants . By creating domain-swap variants between C. crescentus LspA and homologs from E. coli or H. pylori, researchers can identify regions responsible for substrate specificity, inhibitor sensitivity, and interactions with other components of the lipoprotein processing machinery. Comparative enzymatic assays using recombinant variants against a panel of species-specific substrates can reveal differences in recognition elements and processing efficiency. Mass spectrometry analysis of cleavage sites can identify subtle differences in processing precision across species. Additionally, studying the differential effects of inhibitors like globomycin on various LspA homologs can highlight structural divergence in the active site architecture. Together, these approaches provide insights into how evolutionary adaptations in lipoprotein processing systems accommodate the specific physiological requirements of different bacterial species.

What methodological approaches can resolve the membrane topology and structure of C. crescentus LspA?

Resolving the membrane topology and structure of C. crescentus LspA requires a multi-technique approach that addresses the challenges inherent to membrane protein analysis. Cysteine-scanning mutagenesis combined with accessibility labeling provides detailed topological information by identifying residues exposed to either the periplasmic or cytoplasmic environments. In this approach, single cysteine residues are introduced throughout the protein sequence, and their accessibility to membrane-impermeable or membrane-permeable thiol-reactive probes is assessed. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map solvent-accessible regions and conformational dynamics with peptide-level resolution. For higher-resolution structural information, recombinant LspA can be reconstituted into nanodiscs or amphipols to provide a membrane-like environment compatible with cryo-electron microscopy (cryo-EM) analysis. X-ray crystallography remains challenging but feasible using lipidic cubic phase crystallization methods that have proven successful for other bacterial membrane proteins. Computational approaches including molecular dynamics simulations can complement experimental data by predicting conformational states and substrate interactions. These combined methods can generate a comprehensive structural model revealing how the catalytic residues are positioned relative to the membrane interface to facilitate access to lipoprotein substrates.

What role does LspA play in C. crescentus cell cycle regulation and development?

The role of LspA in C. crescentus cell cycle regulation and development presents a fascinating research direction that connects lipoprotein processing to cellular differentiation. While direct evidence is limited, parallels can be drawn with the essential nature of other proteolytic systems like ClpXP in C. crescentus . Investigating this connection requires synchronized cell populations, achieved through density gradient centrifugation or selective adhesion techniques, to isolate cells at specific developmental stages. Quantitative proteomics comparing lipoproteomes across the cell cycle can identify stage-specific lipoprotein processing events mediated by LspA. Conditional depletion systems for LspA using degron tags or inducible antisense RNA allow temporal control of LspA levels to determine critical windows of activity during the cell cycle. Fluorescence microscopy using tagged versions of LspA can reveal potential dynamic localization patterns during development. Co-immunoprecipitation coupled with mass spectrometry can identify interaction partners that may connect LspA to cell cycle regulators. Genetic interaction studies examining synthetic phenotypes between partial loss-of-function LspA variants and cell cycle regulators can uncover functional relationships. These approaches can establish whether LspA-dependent lipoprotein maturation represents a checkpoint in developmental progression, analogous to the essential role of ClpXP in processing critical cell cycle regulators in C. crescentus.

How can researchers overcome expression toxicity when producing recombinant C. crescentus LspA?

Expression toxicity represents a significant challenge when producing recombinant C. crescentus LspA, often resulting from membrane disruption or interference with host cell lipoprotein processing. Several strategies can effectively mitigate these issues. Using tightly regulated expression systems with minimal basal expression, such as the pET system with T7 lysozyme co-expression or the pBAD system with glucose repression, provides precise control over protein production. Lowering induction temperature to 16-20°C significantly reduces toxicity by slowing production rate and allowing proper membrane insertion. Specialized E. coli strains like C41(DE3) and C43(DE3), engineered specifically for toxic membrane protein expression, contain mutations that better accommodate membrane protein overproduction . For extreme cases, cell-free expression systems using E. coli extracts supplemented with detergents or lipid nanodiscs offer an alternative that bypasses in vivo toxicity entirely. Fusion constructs incorporating solubility-enhancing tags such as MBP (maltose-binding protein) can reduce aggregation and membrane disruption. Additionally, dual-plasmid systems where chaperones like DnaK-DnaJ-GrpE are co-expressed enhance proper folding and membrane insertion. Implementation of these strategies typically improves viable cell density by 3-5 fold and increases functional protein yield by an order of magnitude compared to standard conditions.

What approaches effectively resolve contamination issues during C. crescentus LspA purification?

Contamination issues during C. crescentus LspA purification primarily stem from co-purifying membrane proteins, endogenous lipoproteins, and detergent-related artifacts. A systematic multi-step purification strategy effectively addresses these challenges. Initial membrane preparation should include high-salt washes (300-500 mM NaCl) to remove peripherally associated proteins before detergent solubilization. When using affinity chromatography, extended washing steps with buffers containing moderate imidazole concentrations (40-60 mM for His-tagged constructs) and mixed detergents (combining DDM with cholate or OG) significantly reduce non-specific binding. Incorporating an ion exchange chromatography step exploits the unique charge distribution of LspA to separate it from contaminants with similar size but different surface properties. Size exclusion chromatography as a final polishing step not only removes aggregates but also separates monomeric LspA from oligomeric contaminants and empty detergent micelles. For eliminating lipopolysaccharide contamination, which can interfere with functional assays, including polymyxin B during purification or using Triton X-114 phase partitioning proves effective. Purity should be assessed not only by SDS-PAGE but also by mass spectrometry to identify persistent contaminants. This optimized protocol typically achieves >95% purity with specific LspA activity enriched by 50-100 fold compared to the membrane fraction, yielding preparations suitable for structural and mechanistic studies.

How can researchers distinguish between direct and indirect effects in LspA functional studies?

Distinguishing between direct and indirect effects in LspA functional studies presents a significant challenge due to the interconnected nature of lipoprotein processing pathways. A multi-faceted approach combining biochemical, genetic, and temporal analyses provides the necessary resolution. In vitro reconstitution using purified components represents the gold standard for establishing direct effects, where purified LspA, synthetic or purified substrates, and defined reaction conditions can demonstrate unambiguous catalytic activity. Site-directed mutagenesis targeting known catalytic residues (typically serine and lysine in the active site) creates catalytically inactive controls that should eliminate direct effects while preserving protein structure and potential scaffolding functions. Rapid depletion systems such as inducible degrons provide temporal resolution of LspA functions, helping separate immediate consequences (likely direct) from delayed effects (potentially indirect). Quantitative proteomics comparing acute versus chronic LspA depletion can differentiate primary substrates from downstream effects. Comparative analysis across species with different lipoprotein processing networks, similar to approaches used with ClpXP studies, can identify conserved (likely direct) versus species-specific (potentially indirect or contextual) functions . Chemical genetic approaches using sublethal concentrations of globomycin provide an orthogonal method to specifically inhibit LspA activity. By implementing these complementary approaches, researchers can construct a hierarchical model of LspA-dependent processes, clearly delineating direct catalytic functions from downstream cellular responses.

What statistical methods are appropriate for analyzing C. crescentus LspA enzyme kinetics data?

Analysis of C. crescentus LspA enzyme kinetics requires robust statistical approaches that account for the complexities of membrane protein biochemistry. For basic Michaelis-Menten parameter determination, non-linear regression using least squares fitting is appropriate, but should be supplemented with residual analysis to detect systematic deviations that might indicate more complex kinetic models. When detergent micelles or lipid environments complicate substrate concentration calculations, statistical models incorporating partitioning coefficients should be employed. For comparing activity across different LspA variants or conditions, Analysis of Variance (ANOVA) with post-hoc tests (Tukey or Bonferroni) properly controls for multiple comparisons. Bootstrap resampling methods provide robust confidence intervals for kinetic parameters when assumptions of parametric tests are not met. When analyzing inhibition studies, global fitting of multiple inhibitor concentrations to competitive, non-competitive, or mixed models yields more reliable inhibition constants than single-curve analyses. For time-course experiments, repeated measures ANOVA or mixed-effects models account for the non-independence of sequential measurements. Power analysis should be conducted a priori to determine appropriate replicate numbers, typically requiring at least 4-6 independent experiments to detect 30% differences in kinetic parameters with 80% power at α=0.05. These statistical approaches ensure reliable interpretation of kinetic data, enabling valid comparisons between experimental conditions.

How should researchers interpret contradictory results between in vitro and in vivo studies of C. crescentus LspA?

Contradictions between in vitro and in vivo studies of C. crescentus LspA often reveal important biological insights rather than experimental failures. Systematic analysis of these discrepancies should begin by examining differences in experimental conditions. In vitro systems typically use detergent-solubilized enzymes, which may alter substrate specificity or catalytic efficiency compared to the native membrane environment. Researchers should consider reconstituting LspA into proteoliposomes or nanodiscs to better mimic native conditions. The presence of accessory factors in vivo that are absent from purified systems may explain functional differences, warranting pull-down experiments to identify interaction partners. Substrate accessibility represents another key variable—in vitro studies typically use soluble substrate fragments, while in vivo substrates are membrane-anchored and may be presented in specific microdomains. Temporal considerations are critical, as acute biochemical measurements may not capture adaptive responses that occur in vivo. To reconcile contradictions, researchers should develop intermediate complexity systems, such as spheroplast assays or permeabilized cell models, that maintain cellular organization while allowing experimental manipulation. Quantitative systems biology approaches can model the relationship between in vitro kinetic parameters and in vivo phenotypes, identifying missing components that explain discrepancies. The complementary nature of these approaches should be emphasized, with in vitro studies providing mechanistic clarity and in vivo studies establishing physiological relevance, together constructing a more complete understanding of LspA function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.