Recombinant Caulobacter crescentus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
yidC; CCNA_00806; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-615
Protein Length
full length protein
Species
Caulobacter crescentus (strain NA1000 / CB15N)
Target Names
yidC
Target Protein Sequence
MQNDNKNTLMFIVSAFAILIGYQFFVLGPQQKKAEAEFRAKKAAEQQSAAKAGVTLDANG NPAPLRLSRDAAKALSPRIEVDTPALSGSIALKGARIDDLFLRKYDETTKKDSPPVELFR PEGAEHAWFADFGWAGANLPGLPDSRTVWTAAPGQVLRPNSPVTLTYDNGLGLTFTRVIA VDDQAMFTVTDSVKNNGTNGLQLAPYATVQRQGISDALGKNQIVHEGAIGVLGATDEQKL EMAKYGKWKKDKPLQSFDSVGGWTGITDKYWLAALIPGQNQAIKAQYRVTNVAGIDVYDV NFLGPVQVLNPGATVSQTTRLFAGAKTVPLLRKYEYGATPAPAIWEFWNKTKAEIPRFDD AVDWGMFRFFTRPIFNILEVFYKLVGNFGLAILLLTVVLKLVLYPMADKSYESMAKMKKI APEVEKLKAKHKDDPAKQQQEMMALYQKEKINPMMGCLPMLIQIPVFYALYKVLTVTIEM RHAPFFGWIQDLSAPDPTTMFNLFGLIPWDPGSLPLIGAMIAHLGVWPLLYGFTMWLTTA MNPPAGDPIQQKIFQWFPVIFTFTLSGFAVGLVIYWCWSNVLTIFQQYIIMRRYKVENPI DQIIARLRGKTAGAT
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as in the integration of at least some lipoproteins. It also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of YidC in bacterial systems?

YidC serves as a universal membrane protein insertase that mediates the integration of newly synthesized proteins into the cytoplasmic membrane. It functions through two distinct mechanisms:

  • As an independent insertase: YidC can directly facilitate the insertion of certain membrane proteins without requiring additional machinery .

  • In concert with the SecY complex: YidC works cooperatively with the Sec translocon to insert more complex membrane proteins during co-translational protein synthesis .

This protein plays a critical role in maintaining cellular integrity by ensuring proper membrane protein topology and folding. Structural studies reveal that YidC interacts with the ribosome at the ribosomal tunnel exit, creating a dedicated site for membrane protein insertion at the YidC protein-lipid interface . This positioning allows newly synthesized proteins to be directly channeled from the ribosome into the membrane through YidC's hydrophilic groove .

What expression systems are optimal for producing recombinant Caulobacter crescentus YidC?

For successful expression of recombinant Caulobacter crescentus YidC, E. coli expression systems have proven effective. The standard protocol utilizes E. coli as the heterologous expression host with the full-length protein (amino acids 1-615) fused to an N-terminal His tag for purification purposes . This approach allows for high-yield production while maintaining proper folding of the transmembrane segments.

When designing an expression system for YidC, researchers should consider:

  • Selection of appropriate E. coli strain: BL21(DE3) or derivatives optimized for membrane protein expression

  • Vector design: Incorporation of a His-tag (typically N-terminal) for subsequent purification

  • Induction conditions: Temperature, inducer concentration, and expression duration require optimization for membrane proteins

The expression construct should be verified through sequencing to ensure the proper incorporation of the full coding sequence (1-615 amino acids) and the His-tag fusion .

What are the recommended storage and reconstitution protocols for purified YidC protein?

Proper storage and reconstitution are critical for maintaining YidC functionality. Based on established protocols, the following guidelines are recommended:

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended standard is 50%)

  • Aliquot for long-term storage at -20°C/-80°C

Buffer composition:

  • Reconstituted protein should be maintained in a Tris/PBS-based buffer

  • pH should be maintained at approximately 8.0

  • Addition of 6% Trehalose improves stability

These protocols minimize protein degradation and maintain the native structure necessary for functional studies.

What computational approaches are used to study YidC structure and dynamics?

Researchers employ multiple computational techniques to investigate YidC structure and function:

  • Evolutionary co-variation analysis: This approach identifies pairs of residues that have co-evolved, indicating potential structural contacts. The strength of coupling between residues helps predict helix-helix interactions and develop structural models .

  • Molecular docking: To study substrate interactions, docking techniques position potential substrate proteins (like the Pf3 coat protein) within the YidC hydrophilic groove. This allows investigation of different stages of the insertion process .

  • Classical molecular dynamics (MD) simulations: MD simulations evaluate the stability of structural models and characterize conformational changes during protein-substrate interactions. These simulations typically use the CHARMM36m force field with TIP3P water models .

  • Non-equilibrium simulations: These help analyze the dynamic process of substrate insertion through YidC .

The computational workflow typically involves:

  • Initial model preparation using tools like Molecular Operating Environment (MOE)

  • Appropriate protonation state assignment

  • Membrane embedding (commonly using POPE lipids)

  • Solvation and system neutralization

  • Energy minimization followed by equilibration and production runs

These computational approaches provide insights into YidC's structure-function relationships that complement experimental studies.

How do inter-residue interactions contribute to YidC stability and function?

Molecular dynamics simulations reveal critical interactions that maintain YidC's structural integrity and functional capability:

  • Exterior hydrophobic residues: These interact with lipid tails, anchoring YidC in the membrane. The distribution of these residues creates a stable protein-lipid interface .

  • Core stabilizing interactions: The YidC core is maintained through both short and long-range interactions between the five transmembrane helices .

  • Cytoplasmic side interactions: Residues toward the cytoplasmic side of the core are primarily polar or charged, forming strong electrostatic and charge-dipole interactions .

  • Periplasmic side interactions: In contrast, residues on the periplasmic side are predominantly aromatic and engage in stacking and nonpolar dispersion interactions .

Key residues identified through complementation assays include:

  • T362 in TM2 and Y517 in TM6: Mutation of these residues to alanine completely inactivates YidC despite stable expression of the protein

  • Nearby residues F433, M471, and F505 show intermediate activity levels when mutated

  • Residues further from this critical interaction pair do not significantly affect function when mutated

This structural analysis reveals that specific inter-residue interactions, particularly at certain "hotspots" within the transmembrane domains, are essential for YidC function.

How does YidC facilitate SecY-independent membrane protein insertion?

The SecY-independent insertion mechanism of YidC involves several key steps:

  • Initial substrate recognition: YidC recognizes nascent membrane proteins through specific sequence elements or structural features .

  • Substrate binding in hydrophilic groove: The hydrophilic groove of YidC serves as a docking site for incoming substrate proteins. This groove provides a protected environment at the protein-lipid interface .

  • Conformational changes: Upon substrate binding, YidC undergoes conformational changes that facilitate the insertion process. These include movements in the cytoplasmic hairpin region between TM2 and TM3 .

  • Water molecule dynamics: Water molecules within the hydrophilic groove play a critical role during insertion, helping to stabilize hydrophilic segments of the substrate protein .

  • Lateral release: After proper orientation, the substrate protein is released laterally into the lipid bilayer .

Molecular dynamics studies reveal that during this process, both global and local structural changes occur in YidC. The cytoplasmic hairpin region is particularly dynamic, and water molecules within the groove facilitate the accommodation of hydrophilic segments of the substrate protein .

What is the role of YidC in co-translational membrane protein insertion?

YidC plays a crucial role in co-translational membrane protein insertion through its interaction with actively translating ribosomes:

  • Ribosome binding: Cryo-electron microscopy reconstructions show that a single copy of YidC interacts with the ribosome at the ribosomal tunnel exit. This strategic positioning allows direct access to nascent membrane proteins as they emerge from the ribosome .

  • Insertion site formation: YidC creates a dedicated site for membrane protein insertion at the YidC protein-lipid interface. This site serves as an entry point for newly synthesized membrane proteins to enter the lipid bilayer .

  • Translocation assistance: YidC assists in the proper translocation of hydrophilic regions while facilitating the integration of hydrophobic segments into the membrane .

  • Folding assistance: Beyond insertion, YidC aids in the proper folding of membrane proteins into their final three-dimensional structures, acting as a membrane protein chaperone .

This co-translational mode ensures that membrane proteins are inserted directly from the ribosome into the membrane, preventing aggregation of hydrophobic segments in the cytoplasm and ensuring proper topology from the moment of synthesis .

What in vivo complementation assays can assess YidC functionality?

In vivo complementation assays provide a powerful approach to assess the functionality of YidC variants and identify critical residues. A standard methodology involves:

  • Generation of YidC-depleted strains: Create bacterial strains where the endogenous YidC expression can be controlled (typically using arabinose-inducible promoters) .

  • Plasmid construction: Clone wild-type or mutant YidC genes into expression vectors compatible with the depletion strain .

  • Complementation testing: Transform the plasmids into the depletion strain and test growth under YidC-depleting conditions. Functional YidC variants will support growth, while non-functional variants will not .

  • Protein expression verification: Western blotting should be performed to confirm that lack of complementation is due to functional defects rather than expression issues .

This approach successfully identified several functionally critical residues in YidC, including T362 in TM2 and Y517 in TM6, which completely inactivate YidC when mutated to alanine despite stable expression of the protein .

What methods are used to study YidC-ribosome interactions?

Several complementary approaches allow researchers to investigate YidC-ribosome interactions:

  • Cryo-electron microscopy (cryo-EM): This technique provides structural snapshots of YidC-ribosome complexes. Samples typically include translating ribosomes carrying YidC substrates (like FocA) bound to YidC .

  • Ribosome binding assays: Biochemical assays using purified components can quantify the affinity between YidC and ribosomes under various conditions.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry identifies specific contact points between YidC and the ribosome.

  • Ribosome profiling: This technique maps the positions of ribosomes on mRNAs encoding YidC substrates, providing insights into translation pausing that may be related to YidC interaction.

  • Structural fitting: Computational models of YidC are docked into cryo-EM density maps to identify interaction interfaces .

These methods have revealed that YidC interacts with the ribosome precisely at the ribosomal tunnel exit, positioning it perfectly to receive nascent membrane proteins as they emerge from the ribosome . This interaction is critical for the co-translational mode of YidC-mediated membrane protein insertion.

How do YidC-mediated insertion mechanisms differ between bacterial species?

While the YidC protein family is conserved across bacteria, important structural and functional differences exist between species:

  • Transmembrane domain arrangement: Although the five core transmembrane domains are conserved, their precise arrangement and the presence of additional domains can vary. Caulobacter crescentus YidC shares the basic five TM domain structure found in many bacteria .

  • Substrate specificity: Different bacterial YidC homologs show preferences for different substrate proteins, which may relate to the specific membrane protein composition of each organism.

  • Interaction with accessory factors: The dependence on and interaction with other membrane protein insertion machinery (like the Sec translocon) varies between bacterial species.

  • Evolutionary adaptations: Differences in lipid composition between bacterial species likely influenced the evolution of YidC variants optimized for specific membrane environments.

Comparative studies of YidC from E. coli, C. crescentus, and other bacteria reveal that while the core insertion mechanism is conserved, adaptations in specific amino acids and structural elements reflect the specialized requirements of each bacterial species .

What are the critical factors influencing experimental reproducibility in YidC functional studies?

Ensuring reproducibility in YidC functional studies requires careful attention to several critical factors:

  • Protein purification and stability:

    • Maintain consistent purification protocols to ensure uniform protein quality

    • Monitor protein stability through analytical techniques (e.g., size-exclusion chromatography)

    • Use appropriate storage conditions (as detailed in section 2.2) to maintain activity

  • Membrane mimetic environments:

    • For in vitro studies, the choice of membrane mimetic (liposomes, nanodiscs, detergent micelles) significantly impacts YidC activity

    • Lipid composition should be carefully controlled and reported

    • POPE (palmitoyloleoyl phosphatidylethanolamine) lipids are commonly used in simulation studies of YidC

  • Computational methodology standardization:

    • Molecular dynamics simulations should use consistent force fields (CHARMM36m is common)

    • Water models (typically TIP3P) should be standardized

    • Simulation parameters including temperature, pressure controls, and boundary conditions should be reported in detail

  • Experimental conditions for in vivo studies:

    • Growth conditions for complementation assays should be strictly controlled

    • Expression levels of YidC variants should be verified and normalized

    • Background strains must be consistent across experiments

Researchers should consider these factors when designing experiments and interpreting results to ensure consistency and reproducibility across different studies of YidC function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.