Recombinant Caulobacter crescentus Metalloprotease mmpA (mmpA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mmpA; CC_1916; Metalloprotease MmpA; Membrane metalloprotease A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Caulobacter crescentus (strain ATCC 19089 / CB15)
Target Names
mmpA
Target Protein Sequence
MIGFLIMLVSLLFVLSVVVTVHELGHYWAARACGVAIERFSIGFGAPLISWRDKRGVEWC VASIPLGGYVRFAGDENAASVPDQNDLDAMRNEIRRREGDDAVNRYFHFKPVWQRAFIAV AGPMANFILAILVFAVILVSFGAQKTSTTVGEVVAGTPAAAAGFKPGDVILKADNRQIRS FQDIQGYVALRANMPIDFAVERDGRTVHLTATPRLVERQNEISGRVKVGELGLRSAPGGR FERSSLLSAIPDATVEVWDMIKTIAFYLGRLLMGQLPADQISGIIGIGHTAGAVTNGVVE QAPNGKALAIGLIYSQFWLIASLSVSIGFMNLLPIPVLDGGHLVMYAYEAVAKRPLRAEF QAAGFRAGLALILGFMLFAAWNDLNRYDVFKFIGGLFT
Uniprot No.

Target Background

Function

Recombinant Caulobacter crescentus Metalloprotease mmpA (mmpA) is involved in the regulated intramembrane proteolysis (RIP) of the short isoform of PodJ protein (PodJS) during the swarmer-to-stalked cell cycle transition. Cleavage occurs near or within the single transmembrane domain of PodJS, releasing the N-terminal segment into the cytoplasm for subsequent degradation. This process contributes to maintaining cellular asymmetry in subsequent cell cycles through sequential degradation.

Database Links

KEGG: ccr:CC_1916

STRING: 190650.CC_1916

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of mmpA in Caulobacter crescentus?

mmpA functions as a site-2 protease (S2P) that facilitates the degradation of PodJS during the Caulobacter cell cycle. It belongs to the family of membrane-embedded zinc metalloproteases, which includes SpoIVFB and YluC of Bacillus subtilis and YaeL of Escherichia coli . mmpA appears to cleave within or near the transmembrane segment of PodJS, releasing it into the cytoplasm for complete proteolysis . This proteolytic activity is essential for maintaining proper asymmetry in the next cell cycle during the swarmer-to-stalked transition .

The protease participates in regulated intramembrane proteolysis (RIP), a conserved mechanism across many bacterial species . Unlike PodJS, which has a specific temporal and spatial address, mmpA is present throughout the cell cycle and is uniformly distributed around the cell membrane, suggesting its activity is regulated by substrate availability rather than its own localization .

How does mmpA relate to other proteases in the Caulobacter protein quality control network?

mmpA functions within a broader protein quality control (PQC) network in Caulobacter that includes multiple ATP-dependent proteases such as ClpXP, ClpAP, Lon, and HslUV . While proteases like ClpXP have well-characterized roles in cell cycle progression through the degradation of specific regulators like CtrA, mmpA's role appears more specialized in the sequential degradation of cell polarity determinants .

The membrane-bound nature of mmpA distinguishes it from cytosolic proteases and aligns it functionally with other membrane proteases like FtsH, which is involved in regulating stress responses through σ32 degradation . The table below summarizes key proteases in the Caulobacter PQC network:

ProteaseLocalizationKey SubstratesRole in Cell Cycle
mmpAMembranePodJSSwarmer-to-stalked transition
ClpXPCytosolicCtrA, DnaXG1-S transition, DNA replication
LonCytosolicDnaA, SocBDNA replication control
FtsHMembraneσ32Stress response regulation
HslUVCytosolicσ32 (in some conditions)Redundant stress response

How is recombinant mmpA typically expressed and purified for research applications?

Recombinant expression of membrane proteins like mmpA presents unique challenges. Based on methodologies employed for similar membrane proteases, researchers typically use the following approach:

  • Expression system selection: E. coli strains such as C41(DE3) or C43(DE3), specifically designed for membrane protein expression, are recommended. Alternatively, homologous expression in Caulobacter can be explored when native conformation is critical .

  • Vector design: The mmpA gene should be cloned with an appropriate fusion tag (His6, GST, or MBP) to facilitate purification. Inclusion of a cleavable signal sequence can improve membrane integration.

  • Expression conditions: Induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) typically yields better results for membrane proteins by slowing expression and allowing proper folding and membrane insertion.

  • Membrane extraction: Cells are typically lysed and membranes isolated by ultracentrifugation. Membrane proteins require careful solubilization using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin .

  • Purification: Affinity chromatography in the presence of detergent, followed by size exclusion chromatography, is the standard approach. Buffer composition is critical, typically containing 150-300 mM NaCl, 20-50 mM Tris or HEPES (pH 7.5-8.0), and 0.02-0.05% detergent.

What experimental approaches can be used to characterize the substrate specificity of recombinant mmpA?

Characterizing substrate specificity of metalloproteases like mmpA requires multi-faceted approaches:

  • Peptide library screening: Synthetic peptide libraries representing portions of potential substrates (including PodJS) can be incubated with purified recombinant mmpA. Cleavage products can be analyzed by mass spectrometry to identify preferred cleavage sites and consensus sequences .

  • In vitro cleavage assays: Recombinant substrates containing fluorogenic or chromogenic reporters can be developed to monitor proteolytic activity in real-time. For mmpA, designing transmembrane domain-containing substrates in appropriate micelles or liposomes is critical for maintaining native activity .

  • Proteomic identification of substrates: Comparative proteomics between wild-type and mmpA-deficient strains can identify accumulated proteins that may represent direct or indirect substrates. This can be complemented with in vitro validation using recombinant mmpA .

  • Microscale thermophoresis (MST) or surface plasmon resonance (SPR): These techniques can determine binding affinity between mmpA and potential substrate proteins, providing insights into specificity determinants before proteolysis occurs.

  • Biochemical characterization: Determine kinetic parameters (Km, Vmax, kcat) for different substrates to establish preference profiles. Varying pH, ionic strength, and divalent cation concentrations can reveal optimal conditions for activity .

How can researchers investigate the membrane topology and active site structure of mmpA?

Understanding the membrane topology and active site structure of mmpA requires specialized approaches for membrane proteins:

What are the challenges in developing activity assays for recombinant mmpA and how can they be addressed?

Developing reliable activity assays for membrane proteases like mmpA presents several challenges:

  • Membrane environment reconstitution: mmpA requires a lipid environment for proper folding and activity. Researchers can address this by:

    • Using nanodiscs or liposomes to reconstitute mmpA in a native-like membrane environment

    • Testing different lipid compositions that mimic the Caulobacter inner membrane

    • Employing detergent micelles with careful optimization of detergent type and concentration

  • Substrate presentation: Since mmpA cleaves transmembrane segments, substrates must be properly oriented. Approaches include:

    • Co-reconstitution of substrate and enzyme in the same liposomes

    • Development of peptide substrates with membrane-anchoring groups

    • Engineering fusion proteins with reporter groups positioned relative to predicted cleavage sites

  • Detection of proteolytic activity: The transmembrane nature of cleavage makes detection challenging. Solutions include:

    • FRET-based assays where fluorophores are positioned across the predicted cleavage site

    • Mass spectrometry to identify cleaved products

    • Western blotting with antibodies specific to substrate regions flanking the cleavage site

  • Kinetic analysis complications: Membrane proteins often display complex kinetics due to lateral diffusion limitations. Researchers should:

    • Consider two-dimensional kinetic models rather than standard Michaelis-Menten kinetics

    • Vary enzyme:substrate ratios in reconstituted systems to distinguish between single- and multi-turnover conditions

    • Use stopped-flow techniques for capturing rapid kinetic phases

How does the function of mmpA in Caulobacter compare to similar proteases in other bacterial systems?

mmpA belongs to the site-2 protease family with functionally similar counterparts in diverse bacteria. Comparative analysis reveals important insights:

  • Functional conservation: mmpA and E. coli YaeL can complement each other, indicating significant functional conservation despite evolutionary distance . This suggests core mechanisms of intramembrane proteolysis are preserved across bacterial phyla.

  • Regulatory divergence: While the catalytic mechanism is conserved, the regulatory contexts differ significantly:

    • In Caulobacter, mmpA primarily regulates cell cycle progression via PodJS degradation

    • In E. coli, YaeL/RseP mediates stress responses through σE activation

    • In B. subtilis, SpoIVFB controls sporulation by processing pro-σK

  • Structural conservation: Sequence analysis suggests all these proteases share key features:

    • HEXXH zinc-binding motif in the first transmembrane domain

    • Multiple transmembrane helices forming a water-accessible catalytic pocket within the membrane

    • PDZ or PDZ-like domains that may regulate substrate access to the catalytic site

  • Experimental approaches for comparative studies:

    • Heterologous expression of mmpA in other bacterial systems to test functional complementation

    • Domain-swapping experiments to identify specificity determinants

    • Comparative proteomics to identify conserved and species-specific substrates

What approaches can be used to study the cell cycle-dependent regulation of mmpA activity?

Although mmpA protein levels remain constant throughout the Caulobacter cell cycle, its activity appears regulated to ensure proper timing of substrate degradation . Investigating this regulation requires specialized approaches:

  • Synchronizable culture techniques: Caulobacter's natural synchronizability through density centrifugation can be leveraged to isolate populations at defined cell cycle stages .

  • Fluorescent reporter systems: Creating fusion proteins between mmpA substrates and fluorescent proteins can visualize degradation dynamics in live cells throughout the cell cycle.

  • Biochemical activity profiling: Isolating membranes from synchronized cultures at different cell cycle stages to test for variations in mmpA activity using in vitro assays.

  • Protein-protein interaction studies: Identifying potential regulatory partners using techniques such as:

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid screening

    • Proximity labeling approaches (BioID, APEX) adapted for bacterial systems

  • Post-translational modification analysis: Examining whether mmpA undergoes modifications (phosphorylation, acetylation) at different cell cycle stages using phosphoproteomics or targeted mass spectrometry.

  • Spatial regulation studies: Using super-resolution microscopy to track potential changes in mmpA localization or clustering at nanoscale resolution during the cell cycle, despite its apparent uniform distribution at lower resolution .

What protocols are most effective for assessing the activity of recombinant mmpA in reconstituted membrane systems?

Effective assessment of recombinant mmpA activity in reconstituted membrane systems can be achieved through the following protocol framework:

  • Reconstitution system preparation:

    • Prepare small unilamellar vesicles (SUVs) using E. coli polar lipid extract or defined lipid mixtures mimicking Caulobacter membranes

    • Reconstitute purified recombinant mmpA using detergent dilution or dialysis methods, targeting protein:lipid ratios of 1:200 to 1:1000 (w/w)

    • Verify successful reconstitution by freeze-fracture electron microscopy or proteoliposome flotation assays

  • Substrate preparation:

    • Express and purify recombinant PodJS constructs containing the transmembrane domain and flanking regions

    • Label with appropriate fluorophores if using FRET-based detection

    • Reconstitute into separate vesicles or the same vesicles depending on the experimental design

  • Activity assay conditions:

    • Buffer: 50 mM HEPES pH 7.5, 150 mM NaCl, 5 mM MgCl2, 2 mM ZnCl2

    • Temperature: 30°C (optimal for Caulobacter proteins)

    • Time course: 0-240 minutes with multiple sampling points

    • Controls: Heat-inactivated enzyme, assays performed with EDTA to chelate zinc ions

  • Detection methods:

    • SDS-PAGE followed by western blotting with antibodies against substrate

    • FRET measurements if using fluorescently labeled substrates

    • Mass spectrometry of extracted reaction products to identify precise cleavage sites

  • Data analysis:

    • Quantify band intensities from western blots or fluorescence changes

    • Calculate initial rates at different substrate concentrations

    • Analyze using appropriate kinetic models for membrane-embedded enzymes

How can researchers optimize heterologous expression systems for producing functional recombinant mmpA?

Optimizing heterologous expression of functional recombinant mmpA requires addressing several challenges specific to membrane metalloproteases:

  • Expression system selection and optimization:

    • Compare E. coli strains specialized for membrane proteins (C41/C43(DE3), Lemo21(DE3))

    • Test Caulobacter-based expression systems for native-like folding

    • Evaluate eukaryotic systems (P. pastoris, insect cells) for complex membrane proteins

    • Optimize growth temperature (typically 18-25°C) and inducer concentration (0.1-0.5 mM IPTG for E. coli)

  • Vector design strategies:

    • Include fusion partners that improve folding (MBP, SUMO)

    • Incorporate cleavable purification tags (His10, StrepII-tag)

    • Consider codon optimization for the expression host

    • Design constructs with varying N- and C-terminal boundaries to identify optimal expression constructs

  • Membrane extraction optimization:

    • Screen detergents systematically (DDM, LMNG, GDN, DMNG)

    • Test solubilization conditions (detergent:protein ratios of 1:1 to 10:1)

    • Optimize solubilization time (2-16 hours) and temperature (4°C vs. room temperature)

    • Consider styrene maleic acid copolymer (SMA) for native nanodiscs

  • Functional validation methods:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate stability in different buffer conditions

    • Limited proteolysis to confirm proper folding

    • Activity assays against model substrates or synthetic peptides

  • Scale-up considerations:

    • Test high-density fermentation for increased biomass

    • Evaluate fed-batch vs. continuous culture methods

    • Consider using chemical chaperones (glycerol, DMSO at low concentrations)

    • Implement automated purification protocols to maintain consistent quality

What techniques are most suitable for investigating mmpA-substrate interactions in the membrane environment?

Investigating mmpA-substrate interactions within a membrane environment requires specialized techniques that preserve the native lipid context:

  • In situ crosslinking approaches:

    • Photo-crosslinking using unnatural amino acids (p-benzoyl-L-phenylalanine) incorporated at predicted interaction sites

    • Chemical crosslinkers with varying spacer lengths to capture transient interactions

    • Crosslinking followed by mass spectrometry to identify interaction interfaces

  • Fluorescence-based interaction studies:

    • Single-molecule FRET to detect conformational changes during substrate binding

    • Fluorescence correlation spectroscopy (FCS) to measure diffusion coefficients of enzyme-substrate complexes

    • Fluorescence recovery after photobleaching (FRAP) to assess mobility changes upon interaction

  • Native mass spectrometry:

    • Membrane protein-specific native MS with nanodiscs or amphipols

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Ion mobility-mass spectrometry to characterize conformational states

  • Surface-sensitive techniques:

    • Surface plasmon resonance (SPR) with lipid nanodiscs immobilized on sensor chips

    • Quartz crystal microbalance with dissipation monitoring (QCM-D) using supported lipid bilayers

    • Atomic force microscopy (AFM) to visualize protein complexes in membrane mimetics

  • Computational approaches:

    • Molecular dynamics simulations of mmpA-substrate interactions in explicit membrane models

    • Coarse-grained simulations to capture larger-scale membrane reorganization during proteolysis

    • Integrated modeling combining experimental constraints with computational predictions

How can researchers develop genetic systems to study mmpA function in vivo?

Developing genetic systems to study mmpA function in vivo requires careful consideration of its essential nature in Caulobacter:

  • Conditional expression systems:

    • Implement xylose-inducible or vanillate-inducible promoters for titratable expression

    • Use degradation tags (e.g., DAS+4) for inducible protein depletion

    • Employ CRISPRi for conditional knockdown of native mmpA expression

  • Allelic replacement strategies:

    • Generate point mutations in catalytic residues to create activity-deficient variants

    • Create domain deletion variants to assess functional contributions of different protein regions

    • Implement scarless genome editing using two-step recombination or CRISPR-Cas9

  • Reporter systems for in vivo activity:

    • Develop fluorescent protein fusions to mmpA substrates with quantifiable readouts

    • Create split fluorescent protein complementation systems to monitor protein-protein interactions

    • Implement transcriptional reporters regulated by pathways downstream of mmpA activity

  • High-throughput mutagenesis approaches:

    • Random mutagenesis coupled with selection for functional variants

    • Deep mutational scanning to comprehensively assess residue contributions

    • Suppressor screening to identify genetic interactions

  • Microscopy-based assays:

    • Fluorescent protein fusions to track localization dynamics

    • Photoactivatable fluorescent proteins for pulse-chase analysis of protein turnover

    • Super-resolution microscopy to visualize nanoscale organization of mmpA and substrates

  • Integration with cell cycle synchronization:

    • Combine genetic tools with synchronization techniques to study cell-cycle specific functions

    • Use microfluidic platforms for single-cell tracking over multiple generations

    • Implement optogenetic control systems for precise temporal manipulation of protein activity

How might recombinant mmpA be utilized in synthetic biology applications?

The site-specific proteolytic activity of mmpA presents interesting opportunities for synthetic biology applications:

  • Engineered signaling pathways:

    • Design synthetic transmembrane signaling systems where mmpA activity releases transcription factors

    • Create tunable protein degradation switches for metabolic engineering

    • Develop protease-activated genetic circuits with programmable response dynamics

  • Controlled protein secretion systems:

    • Engineer mmpA to recognize designer substrates for controlled release of proteins from cells

    • Develop proteolytically activated protein secretion for biotechnological applications

    • Create systems where environmental stimuli trigger mmpA-dependent release of therapeutic proteins

  • Biomaterial applications:

    • Use mmpA for controlled degradation of protein-based biomaterials

    • Develop self-assembling protein systems with programmed disassembly via mmpA

    • Create responsive surfaces where proteolysis changes material properties

  • Biosensor development:

    • Engineer mmpA-based biosensors where substrate cleavage generates detectable signals

    • Develop whole-cell biosensors with mmpA activity linked to reporter gene expression

    • Create biosensors for detecting environmental contaminants that inhibit metalloprotease activity

  • Protein engineering platforms:

    • Use directed evolution of mmpA to generate proteases with novel substrate specificities

    • Develop proteolytic processing systems for producing proteins with specific N- or C-termini

    • Create orthogonal protease-substrate pairs for sophisticated protein circuit engineering

What is known about the evolutionary conservation of mmpA across bacterial species and its implications for research?

The evolutionary conservation of mmpA across bacterial species offers valuable insights for comparative research:

  • Phylogenetic distribution and conservation:

    • mmpA belongs to the S2P family of metalloproteases found across bacterial phyla

    • Highest conservation observed in alpha-proteobacteria

    • Functional complementation between Caulobacter mmpA and E. coli YaeL demonstrates conservation of core mechanisms

  • Domain architecture variations:

    • Core catalytic domains with HEXXH motif are highly conserved

    • Regulatory domains show greater variability, suggesting adaptation to different cellular contexts

    • Differences in transmembrane topology correlate with substrate specificity across species

  • Substrate recognition evolution:

    • Conservation analysis of substrate-binding residues can predict substrate preferences

    • Co-evolution analysis between proteases and their substrates reveals adaptation mechanisms

    • Variations in recognition motifs provide insights into developing species-specific inhibitors

  • Implications for heterologous expression:

    • Expression of evolutionary variants can identify constructs with improved stability

    • Chimeric proteins combining domains from different species may enhance specific properties

    • Understanding conservation patterns aids in designing constructs for structural studies

  • Biotechnological applications:

    • Mining biodiversity for novel S2P family proteases with unique properties

    • Identifying thermostable or otherwise robust variants for industrial applications

    • Engineering hybrid enzymes with combined properties from different evolutionary lineages

How can structural biology techniques be optimized for studying membrane metalloproteases like mmpA?

Structural characterization of membrane metalloproteases presents unique challenges requiring specialized approaches:

  • Cryo-electron microscopy optimization:

    • Use of amphipols or nanodiscs to maintain native-like environment

    • Implementation of Volta phase plates for improved contrast

    • Application of focused refinement strategies for flexible regions

    • Development of lipid nanodisc libraries with varying compositions to optimize stability

  • X-ray crystallography approaches:

    • Lipidic cubic phase (LCP) crystallization tailored for metalloproteases

    • Surface engineering to create crystal contacts while preserving catalytic domains

    • Incorporation of antibody fragments or nanobodies to stabilize conformations

    • Micro-crystallography at X-ray free electron lasers (XFELs) for small crystals

  • Nuclear magnetic resonance techniques:

    • Selective isotope labeling strategies for large membrane proteins

    • Solid-state NMR for structure determination in lipid environments

    • Solution NMR of isolated soluble domains combined with integrative modeling

    • Paramagnetic relaxation enhancement to map substrate binding sites

  • Integrative structural biology:

    • Combining low-resolution cryo-EM with high-resolution crystallography of domains

    • Validation using crosslinking mass spectrometry and SAXS/SANS

    • Computational modeling constrained by experimental data

    • Application of AlphaFold or RoseTTAFold predictions as starting models

  • Time-resolved structural studies:

    • Mix-and-inject serial crystallography to capture catalytic intermediates

    • Time-resolved cryo-EM to visualize conformational changes during catalysis

    • Temperature-jump NMR to measure dynamics on physiologically relevant timescales

By implementing these advanced methodologies, researchers can overcome the challenges inherent in studying membrane metalloproteases like mmpA, advancing our understanding of their structure-function relationships and enabling the development of new applications in biotechnology and synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.