Recombinant Caulobacter crescentus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please include them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize development according to your specifications.
Synonyms
nuoK; CCNA_02018; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Caulobacter crescentus (strain NA1000 / CB15N)
Target Names
nuoK
Target Protein Sequence
MIGLPHYLVVAAILFTIGVFGIFVNRKNVIVILMSIELILLAVNINLVAFSAYLHDVAGQ IFAMFVLTVAAAEAAVGLAILVTFFRNRGDIAVDDASMMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. NDH-1 couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the nuoK subunit interact with other components of the respiratory chain in C. crescentus?

The nuoK subunit interacts with other membrane subunits of Complex I to form a functional proton-pumping module. Based on structural homology with other bacterial NADH-quinone oxidoreductases, nuoK likely forms hydrophobic interactions with adjacent subunits like nuoA, nuoJ, and nuoL to create proton translocation channels. These interactions are essential for coupling electron transport to proton pumping across the membrane, contributing to the proton motive force that drives ATP synthesis in C. crescentus.

What expression systems are most effective for producing recombinant C. crescentus nuoK?

The most effective expression systems for recombinant C. crescentus nuoK utilize the bacterium's own surface layer (S-layer) display capabilities. C. crescentus has been successfully used to express recombinant proteins on its surface by fusing target proteins to the RsaA S-layer protein . For nuoK expression, researchers should consider:

  • Homologous expression within C. crescentus using inducible promoters

  • Heterologous expression in E. coli using specialized membrane protein expression strains (C41/C43)

  • Cell-free expression systems for toxic membrane proteins

A methodological approach requires careful optimization of induction conditions, detergent selection for membrane protein solubilization, and stabilization of the hydrophobic nuoK during purification.

Expression SystemAdvantagesChallengesYield Potential
C. crescentus homologousNative folding environment, S-layer display capabilitySlower growth, fewer genetic toolsModerate
E. coli heterologousRapid growth, extensive genetic toolsPotential folding issuesHigh
Cell-free systemAvoids toxicity issuesExpensive, lower yieldLow

How can researchers optimize the purification of recombinant nuoK while maintaining its structural integrity?

Purification of recombinant nuoK requires careful consideration of its membrane protein nature. The following protocol optimizes purification while preserving structural integrity:

  • Solubilization: Use mild detergents (DDM, LMNG) at concentrations just above CMC

  • Affinity chromatography: Employ His-tag or other fusion tags with detergent in all buffers

  • Size exclusion chromatography: Remove aggregates and ensure homogeneity

  • Stability assessment: Monitor protein stability through thermal shift assays

It's critical to maintain detergent concentrations above CMC throughout all purification steps to prevent protein aggregation. Researchers should also consider incorporating lipids during purification to stabilize the native-like environment of nuoK. Success in purification can be monitored through Western blotting and activity assays to ensure the protein remains functionally intact.

What approaches are most effective for studying nuoK function in the context of the complete NADH-quinone oxidoreductase complex?

When studying nuoK within the complete NADH-quinone oxidoreductase complex, researchers should employ a multi-faceted approach:

  • Genetic manipulation: Generate nuoK deletion or point mutants in C. crescentus to observe phenotypic effects on respiratory function

  • Membrane vesicle preparations: Isolate inside-out membrane vesicles to measure NADH:quinone oxidoreductase activity

  • Reconstitution experiments: Purify the entire complex or subcomplex containing nuoK and reconstitute into liposomes

  • Crosslinking studies: Use crosslinking agents to identify interaction partners of nuoK within the complex

Functional assays should include measurements of:

  • NADH oxidation rates (spectrophotometric assay at 340 nm)

  • Proton pumping efficiency (using pH-sensitive fluorescent dyes)

  • Membrane potential generation (using voltage-sensitive dyes)

Researchers should consider the asymmetric cell division cycle of C. crescentus, as protein function may vary between swarmer and stalked cells .

How can researchers assess the impact of nuoK mutations on C. crescentus respiration and energy metabolism?

To assess the impact of nuoK mutations, researchers should:

  • Generate site-directed mutations targeting conserved residues in nuoK

  • Measure growth rates under different carbon sources and oxygen availability

  • Determine oxygen consumption rates using respirometry

  • Analyze ATP production using luciferase-based assays

  • Measure membrane potential using fluorescent probes

Researchers must correlate phenotypic changes with biochemical measurements, particularly when data contradicts the initial hypothesis. Thorough data examination is critical for identifying discrepancies between expected and observed results . When mutations produce unexpected phenotypes, consider alternative explanations such as compensatory mechanisms or regulatory adaptations in C. crescentus.

What are the most appropriate techniques for determining the structure of nuoK within the membrane environment?

The most appropriate techniques for determining nuoK structure in the membrane environment include:

  • Cryo-electron microscopy (cryo-EM): Particularly suitable for membrane proteins within larger complexes

  • X-ray crystallography: Requires detergent-solubilized protein and crystallization

  • Nuclear magnetic resonance (NMR): Useful for dynamic studies of smaller membrane proteins or fragments

  • Molecular dynamics simulations: Complements experimental data to model membrane interactions

For nuoK specifically, cryo-EM offers advantages due to its small size and integration within the larger Complex I structure. Researchers should consider using nanodiscs or amphipols to maintain a native-like lipid environment during structural studies.

TechniqueResolution RangeSample RequirementsAdvantages for nuoK Study
Cryo-EM2.5-4Å~0.1mg purified proteinVisualizes membrane environment
X-ray crystallography1.5-3ÅWell-diffracting crystalsHigher resolution of static structure
NMRSite-specificIsotope-labeled proteinDynamic information
Molecular dynamicsAtomisticStructural starting modelMembrane interaction insights

How can computational modeling complement experimental approaches in understanding nuoK structure-function relationships?

Computational modeling provides valuable insights into nuoK structure-function relationships through:

  • Homology modeling: Using known structures of bacterial Complex I to predict C. crescentus nuoK structure

  • Molecular dynamics simulations: Evaluating protein stability and conformational changes in a membrane environment

  • Electrostatic surface analysis: Identifying potential proton pathways through nuoK

  • Energy calculations: Assessing the energetics of proton translocation

The implementation process should include:

  • Multiple sequence alignment with homologous proteins

  • Template identification and quality assessment

  • Model building with membrane-specific force fields

  • Refinement and validation against experimental data

Researchers should integrate computational predictions with experimental validation, particularly when investigating proton translocation mechanisms or evaluating the effects of mutations on protein function.

What approaches should researchers take when experimental data about nuoK contradicts bioinformatic predictions?

When experimental data contradicts bioinformatic predictions about nuoK, researchers should:

  • Thoroughly examine the data: Look for technical artifacts, experimental variability, or outliers

  • Reassess bioinformatic assumptions: Check for errors in sequence alignment, inappropriate templates, or algorithm limitations

  • Design validation experiments: Create targeted experiments to specifically test the contradiction

  • Consider biological context: Evaluate if C. crescentus has unique evolutionary adaptations that might explain discrepancies

It's critical to approach contradictions as opportunities for discovery rather than errors. Researchers should document both the predicted and experimental outcomes, and systematically evaluate methodological variables that might explain the discrepancy . When appropriate, consider publishing contradictory findings as they may represent novel biological insights.

How should researchers interpret growth defects in nuoK mutants that show unexpected respiratory chain activity?

When nuoK mutants exhibit growth defects despite unexpected respiratory chain activity, researchers should:

  • Validate measurements: Confirm both growth and enzymatic activity measurements using multiple methods

  • Investigate compensatory mechanisms: Examine upregulation of alternative respiratory complexes

  • Assess metabolic rewiring: Analyze metabolomic changes that might indicate alternative energy generation pathways

  • Evaluate pleiotropic effects: Consider if nuoK might have secondary functions beyond respiration

Interpretation requires distinguishing between direct effects of nuoK mutation and downstream adaptations. Consider that C. crescentus undergoes complex cell cycle regulations , and mutations might affect different cell types (swarmer vs. stalked) differently. When analyzing contradictory data, researchers should evaluate initial assumptions about nuoK function and consider alternative hypotheses that might explain the observed phenotypes .

How can the S-layer display capabilities of C. crescentus be leveraged to study nuoK interactions with other respiratory complexes?

The S-layer display capabilities of C. crescentus provide a unique platform for studying nuoK interactions by:

  • Creating fusion proteins between nuoK fragments and RsaA S-layer protein

  • Displaying interaction domains on the cell surface for accessibility studies

  • Developing FRET-based interaction assays using fluorescently labeled interaction partners

  • Engineering cross-linking sites to capture transient protein-protein interactions

C. crescentus has demonstrated effective S-layer protein display that has been previously utilized for recombinant protein expression . This system can be adapted to study membrane protein interactions by carefully designing constructs that display key interaction domains while maintaining proper folding.

The approach should include:

  • Bioinformatic identification of potential interaction domains

  • Creation of a library of S-layer fusion constructs

  • Development of quantitative binding assays

  • Correlation of interaction data with functional measurements

What are the most promising approaches for utilizing recombinant nuoK in synthetic biology applications?

Recombinant nuoK from C. crescentus offers several promising synthetic biology applications:

  • Engineered bioenergetic systems: Creating synthetic electron transport chains with optimized energy conversion efficiency

  • Biosensors: Developing membrane potential sensors based on modified nuoK

  • Minimal respiratory systems: Engineering simplified respiratory complexes for controlled proton translocation

  • Protein scaffolds: Using nuoK's membrane integration properties to anchor other proteins

Implementation requires:

  • Domain mapping to identify functional modules

  • Protein engineering to enhance stability outside native complex

  • Development of activity assays for synthetic constructs

  • Optimization of expression in heterologous hosts

Researchers should draw inspiration from C. crescentus recombinant protein display systems that have shown success in other applications, such as HIV-1 microbicides . The non-pathogenic nature of C. crescentus makes it a potentially safe chassis for engineering applications.

What are the most common challenges in expressing and purifying functional recombinant nuoK, and how can researchers overcome them?

Common challenges in nuoK expression and purification include:

  • Low expression levels: Optimize codon usage, use C41/C43 E. coli strains, or test C. crescentus homologous expression

  • Protein misfolding: Lower induction temperature (16-20°C), add chemical chaperones

  • Aggregation during purification: Screen multiple detergents, include lipids during extraction

  • Loss of activity: Maintain proper detergent:protein ratio, add stabilizing agents (glycerol, specific lipids)

ChallengeSolutionImplementation
Low expressionUse C. crescentus S-layer displayFuse nuoK to RsaA with appropriate signal sequences
Membrane integrationOptimize leader sequencesTest multiple leader peptides for proper targeting
Protein aggregationDetergent screeningSystematic testing of detergent types and concentrations
InstabilityLipid supplementationAdd E. coli polar lipids during purification

When troubleshooting, implement systematic documentation of conditions and outcomes to identify patterns in successful expression and purification .

How can researchers address inconsistent results in nuoK functional assays?

To address inconsistent results in nuoK functional assays, researchers should:

  • Standardize preparation methods: Develop detailed protocols for membrane preparation and protein isolation

  • Control environmental variables: Maintain consistent temperature, pH, and ionic conditions during assays

  • Include internal standards: Add known concentrations of control samples in each experiment

  • Validate multiple activity measurements: Use complementary assays to confirm functional observations

  • Implement statistical quality control: Establish acceptance criteria for technical and biological replicates

When inconsistencies arise, researchers should examine the data thoroughly to identify possible sources of variability . Consider both technical factors (reagent quality, instrument calibration) and biological factors (growth phase, media composition). Document all experimental conditions meticulously to identify variables that might explain discrepancies between experiments.

Developing a standardized protocol with appropriate controls and implementing rigorous data analysis practices will help distinguish between true biological variability and technical artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.