Recombinant Caulobacter crescentus Probable intracellular septation protein A (CC_3678)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Caulobacter crescentus Probable Intracellular Septation Protein A (CC_3678)

Recombinant CC_3678 is a bioengineered protein derived from Caulobacter crescentus, a model organism for studying asymmetric cell division. The protein, also known as YciB, is annotated as a probable intracellular septation protein involved in cellular processes. Its recombinant form is produced via bacterial expression systems (e.g., E. coli) and retains structural and functional integrity for research applications .

Cellular Septation

CC_3678 is hypothesized to participate in intracellular septation, a critical step in bacterial cell division. Its full-length expression in C. crescentus may enable studies on:

  • Septum Formation: Coordination with other division machinery (e.g., FtsZ, Min proteins).

  • Membrane Dynamics: Role in membrane remodeling during cell division .

Comparative Studies

Recombinant CC_3678 serves as a tool for:

  • Protein-Protein Interactions: Identifying binding partners in septation complexes.

  • Structural Analyses: X-ray crystallography or cryo-EM studies to elucidate membrane-binding mechanisms .

Purity and Integrity

Recombinant CC_3678 exhibits >90% purity, validated via SDS-PAGE, ensuring minimal contamination for downstream assays .

Stability and Handling

ParameterRecommendation
Storage-20°C/-80°C (aliquoted); avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol added
Working Aliquots4°C for ≤1 week

Knowledge Gaps

  • Functional Mechanism: Limited data on CC_3678’s molecular role in septation.

  • Pathway Integration: No annotated pathways involving CC_3678 are currently reported .

Research Priorities

  • Proteomic Studies: Mapping interactions with divisome components (e.g., FtsA, FtsN).

  • Knockout Models: Assessing phenotypic effects of CC_3678 deletion in C. crescentus .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand you may have specific needs. Please indicate your desired format during the order process, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate your preference in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, centrifuge the vial briefly before opening to ensure the contents settle at the bottom. We recommend reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yciB; CC_3678; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Caulobacter crescentus (strain ATCC 19089 / CB15)
Target Names
CC_3678
Target Protein Sequence
MRTVVDYGAAIAFGVAYFVTKDFQKATWVLVAASAAALAIGYAVERRLAMLPLFFGGMAL VFGTLGLIFGSDVFVKIKVTVINLALASFLVGGVLLKRQPLKVIMGEALHLPDAAWRTLT LRYGAYFAFVAIINEVVRNTQDTDTWVKFRLALLPVALVFVATQLPFMMKHMAKGDDAKA VEPPDAGF
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: ccr:CC_3678

STRING: 190650.CC_3678

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Caulobacter crescentus Probable intracellular septation protein A (CC_3678) and what is its functional significance?

Caulobacter crescentus Probable intracellular septation protein A (CC_3678) is a protein encoded by the CC_3678 gene in Caulobacter crescentus (strain ATCC 19089 / CB15). As indicated by its name, this protein is likely involved in the intracellular septation process during bacterial cell division. The protein has been identified and registered in the UniProt database with the accession number Q9A288 . Based on its amino acid sequence and predicted structure, it appears to be a membrane-associated protein that may play a crucial role in the formation of the septum during cell division in C. crescentus. The specific molecular mechanisms through which CC_3678 contributes to bacterial cell division are still being investigated by researchers, making it an important target for fundamental microbiological research focused on bacterial reproduction and cell cycle regulation.

How should CC_3678 be stored and handled to maintain protein stability and activity?

For optimal stability and activity preservation of recombinant CC_3678, researchers should follow these methodological guidelines:

  • Storage temperature: Store the protein at -20°C for regular use, or at -80°C for extended storage periods .

  • Buffer composition: The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein's stability .

  • Aliquoting strategy: To prevent protein degradation from repeated freeze-thaw cycles, prepare small working aliquots and store them at 4°C for up to one week. Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

  • Handling precautions: When working with the protein, maintain the cold chain and use sterile techniques to prevent contamination. For functional assays, consider the protein's transmembrane nature when selecting appropriate reaction conditions and detergents.

Following these guidelines will help ensure that experiments with CC_3678 yield reproducible and reliable results by preserving the protein's native structure and function.

What expression systems are most effective for producing recombinant CC_3678, and how can expression challenges be overcome?

Expressing full-length CC_3678 presents several challenges due to its transmembrane nature and potential toxicity to host cells. Based on experience with similar proteins, researchers should consider the following methodological approaches:

Expression System Selection:

  • E. coli-based systems: While commonly used, these may be challenging for CC_3678 due to its hydrophobic regions and potential toxicity. Consider using C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression .

  • Eukaryotic expression systems: For better folding of complex membrane proteins, insect cell (Sf9, High Five) or mammalian cell (HEK293, CHO) systems may provide advantages, though with higher cost and complexity.

Optimization Strategies:

  • Codon optimization: Analyzing the CC_3678 sequence for rare codons in the expression host and optimizing accordingly can improve expression levels .

  • Fusion tags: N-terminal tags like MBP or SUMO can enhance solubility, while C-terminal tags can help identify full-length protein expression. Using tags at both ends can help distinguish full-length proteins from truncated products .

  • Induction conditions: Lowering the induction temperature (16-18°C) and using reduced inducer concentrations can promote proper folding and reduce toxicity.

  • Detergent screening: For extraction and purification, systematic screening of detergents (DDM, LMNG, etc.) is crucial for maintaining protein structure and function.

When facing truncated products, increasing imidazole concentration during elution can help separate full-length proteins from fragments . Additionally, specialized membrane protein extraction platforms that maintain native conformation should be considered for functional studies.

What analytical techniques are most appropriate for studying the structure-function relationship of CC_3678?

To elucidate the structure-function relationship of CC_3678, researchers should employ a multi-technique approach:

Structural Analysis Methods:

  • X-ray crystallography: Challenging for membrane proteins like CC_3678, but potentially providing high-resolution structural data. Success may require protein engineering to improve crystallization propensity.

  • Cryo-electron microscopy (Cryo-EM): Increasingly valuable for membrane proteins, allowing visualization in near-native states without crystallization.

  • Nuclear Magnetic Resonance (NMR): Useful for studying dynamic regions and ligand interactions, though challenging for the full-length protein due to size limitations.

  • Computational modeling: Leveraging AI-based prediction tools like AlphaFold2 can provide initial structural insights, particularly valuable when experimental data is limited .

Functional Analysis Methods:

  • Site-directed mutagenesis: Systematic mutation of conserved residues to identify functional domains involved in septation.

  • Fluorescence microscopy: Tagging CC_3678 with fluorescent proteins to track localization during the cell cycle.

  • Protein-protein interaction studies: Co-immunoprecipitation, pull-down assays, or bacterial two-hybrid systems to identify interaction partners.

  • In vivo complementation: Expressing mutant variants in CC_3678-deleted strains to assess functional recovery.

Integration of structural data with functional analyses is essential for understanding how the three-dimensional architecture of CC_3678 enables its role in bacterial septation. Researchers should also consider emerging techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) for mapping dynamic regions and interaction interfaces.

How can researchers investigate the role of CC_3678 in Caulobacter crescentus cell cycle regulation?

Investigating CC_3678's role in cell cycle regulation requires a systematic approach combining genetic, biochemical, and imaging techniques:

Genetic Approaches:

  • Gene deletion and complementation: Create ΔCC_3678 strains and assess phenotypic changes in cell division, morphology, and growth rates. Complement with wild-type and mutant versions to validate observations.

  • Conditional expression systems: Develop strains with inducible or repressible CC_3678 expression to study effects of protein depletion or overexpression at specific cell cycle stages.

  • Fluorescent tagging: Generate strains expressing CC_3678-fluorescent protein fusions for real-time visualization during cell cycle progression.

Biochemical and Molecular Approaches:

  • Phosphorylation studies: Investigate whether CC_3678 is regulated by phosphorylation during the cell cycle using mass spectrometry and phospho-specific antibodies.

  • Chromatin immunoprecipitation (ChIP): Determine if CC_3678 associates with specific DNA regions during septation.

  • RNA-seq analysis: Compare transcriptomes of wild-type and ΔCC_3678 strains to identify affected pathways.

Advanced Microscopy Techniques:

  • Time-lapse microscopy: Track CC_3678 localization throughout the cell cycle in synchronized cultures.

  • Super-resolution microscopy: Visualize CC_3678 distribution relative to other septation proteins with nanometer precision.

  • FRET/BRET analysis: Study protein-protein interactions in real-time during septation.

By integrating these approaches, researchers can establish how CC_3678 coordinates with other septation proteins and regulatory mechanisms to ensure proper cell division timing and execution in Caulobacter crescentus.

What are the most effective protein-protein interaction assays for identifying CC_3678 binding partners in septation complexes?

Identifying the protein-protein interactions of CC_3678 is crucial for understanding its role in septation complexes. Given its transmembrane nature, specialized approaches are recommended:

In vivo Interaction Methods:

  • Bacterial two-hybrid (B2H) systems: Particularly useful for initial screening of potential interaction partners in a cellular context. Split-ubiquitin B2H variants are better suited for membrane proteins like CC_3678.

  • Proximity-dependent biotin identification (BioID): By fusing CC_3678 to a promiscuous biotin ligase, researchers can identify proteins that come into proximity during septation.

  • Förster resonance energy transfer (FRET): Using fluorescent protein fusions to detect direct interactions in live cells, providing spatial and temporal information about CC_3678 complexes during division.

In vitro Biochemical Methods:

  • Co-immunoprecipitation with cross-linking: Using membrane-permeable crosslinkers to stabilize transient interactions before cell lysis and immunoprecipitation.

  • Pull-down assays: Immobilizing purified CC_3678 on a solid support to capture interaction partners from cell lysates, with careful detergent selection to maintain protein structure.

  • Surface plasmon resonance (SPR): For quantitative analysis of binding kinetics between CC_3678 and purified candidate proteins.

Mass Spectrometry-Based Approaches:

  • Quantitative affinity purification mass spectrometry: Comparing samples from tagged CC_3678 pull-downs versus controls to identify specific interactors.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Mapping interaction interfaces by detecting changes in solvent accessibility upon complex formation.

How should researchers design mutagenesis experiments to identify critical functional domains of CC_3678?

Designing effective mutagenesis experiments for CC_3678 requires a systematic approach targeting key regions while considering the protein's membrane topology:

Mutation Strategy Planning:

  • Sequence conservation analysis: Align CC_3678 with homologs from related species to identify evolutionarily conserved residues, which are more likely to be functionally important.

  • Structural prediction-guided mutagenesis: Use computational models to identify potential functional domains, membrane-spanning regions, and solvent-exposed residues that might participate in protein-protein interactions.

  • Scanning mutagenesis: Consider alanine scanning for systematic analysis of transmembrane regions, or charged residue scanning to disrupt specific interactions.

  • Domain swapping: Replace putative functional domains with corresponding regions from related proteins to assess domain-specific functions.

Mutation Types to Consider:

  • Conservative substitutions: Replace residues with chemically similar amino acids to test specific chemical properties.

  • Non-conservative substitutions: Dramatically change chemical properties to completely disrupt function.

  • Deletions and insertions: Remove or add residues at potential linker regions to test spatial requirements.

  • Introduction of reporter sites: Add cysteine residues at strategic positions for subsequent labeling in accessibility studies.

Functional Validation Methods:

  • Complementation testing: Introduce mutant variants into ΔCC_3678 strains and assess restoration of normal septation.

  • Localization studies: Determine if mutations affect the proper subcellular localization of the protein during cell division.

  • Interaction mapping: Test if specific mutations disrupt interactions with identified binding partners.

  • Phenotypic analysis: Quantify cell morphology, division rate, and septum formation in cells expressing mutant proteins.

Researchers should develop a mutation library covering different regions of CC_3678 and implement a systematic screening approach to evaluate multiple aspects of protein function for each variant. Data should be analyzed to correlate structure with function and identify critical residues for specific aspects of CC_3678 activity.

What synchronization methods are most appropriate for studying CC_3678 dynamics during the Caulobacter cell cycle?

Studying CC_3678 dynamics during the cell cycle requires effective synchronization methods to obtain populations of cells at specific stages. For Caulobacter crescentus research, consider these methodological approaches:

Established Synchronization Techniques:

  • Density gradient centrifugation: Separate swarmer cells from stalked cells based on density differences in Percoll or Ludox gradients. This technique provides good initial synchrony but may have limited yield.

  • Adhesion-based selection: Utilize the differential adhesion properties of swarmer versus stalked cells to selectively isolate one population. This can be implemented using glass wool columns or specialized filtration methods.

  • Cold shock synchronization: Expose cells to low temperatures (4°C) for defined periods, which preferentially arrests cells at specific cycle stages. Upon return to normal temperature, cells resume division in a relatively synchronized manner.

Optimization Parameters:

  • Culture conditions: Growth phase, media composition, and temperature significantly impact synchronization efficiency. Optimize these parameters for your specific strain.

  • Timing considerations: Determine the optimal duration for each synchronization step based on preliminary experiments with your strain.

  • Cell density: Initial cell density affects synchronization efficiency; standardize this parameter for reproducible results.

Post-synchronization Analysis:

  • Validation methods: Confirm synchrony by microscopic examination of morphological markers, flow cytometry, or marker gene expression.

  • Time-course sampling: Design appropriate time intervals for sample collection based on the Caulobacter cell cycle duration (approximately 150 minutes under standard conditions).

  • CC_3678 dynamics tracking: Combine synchronization with fluorescence microscopy of tagged CC_3678 or quantitative immunoblotting to monitor protein levels and localization throughout the cell cycle.

For optimal results, researchers should consider implementing a combination of synchronization methods and validate the degree of synchrony achieved before proceeding with CC_3678 dynamics studies. Additionally, time-lapse microscopy of individual cells can complement population-based approaches by providing single-cell resolution of protein dynamics.

How should researchers interpret discrepancies between in vitro and in vivo studies of CC_3678 function?

When encountering discrepancies between in vitro and in vivo findings regarding CC_3678 function, researchers should consider:

Sources of Discrepancies:

  • Protein conformation differences: In vitro studies often use recombinant proteins that may lack proper folding, post-translational modifications, or membrane integration present in vivo.

  • Missing cellular context: In vitro experiments lack the complete complement of interaction partners, physiological concentrations of substrates, and cellular compartmentalization.

  • Temperature and buffer conditions: In vitro assays are typically performed under standardized conditions that may differ from the bacterial cytoplasmic environment.

  • Protein concentration effects: In vitro studies often use protein concentrations higher than physiological levels, potentially creating artificial interactions or activities.

Methodological Approaches to Reconcile Discrepancies:

  • Membrane mimetics: For in vitro studies, incorporate appropriate membrane mimetics (nanodiscs, liposomes) that better represent the native environment of CC_3678.

  • Reconstitution experiments: Gradually increase complexity in in vitro systems by adding purified interaction partners identified in vivo.

  • In-cell validation: Use techniques like FRET or crosslinking to directly test protein interactions in the cellular context.

  • Genetic suppressors: Screen for genetic suppressors of CC_3678 mutant phenotypes to identify functional relationships that may explain discrepancies.

Interpretation Framework:

  • Hierarchical assessment: Consider in vivo results as the reference standard for physiological relevance, using in vitro findings to elucidate molecular mechanisms.

  • Complementary perspective: View discrepancies as complementary information rather than contradictions, potentially revealing regulatory mechanisms or context-dependent functions.

  • Integrated modeling: Develop models that incorporate both in vitro biochemical parameters and in vivo observations, explicitly noting assumptions and limitations.

By systematically investigating the sources of discrepancies and integrating multiple lines of evidence, researchers can develop a more complete understanding of CC_3678 function that reconciles seemingly contradictory results from different experimental approaches.

What bioinformatic approaches can help predict functional domains and interaction sites in CC_3678?

Modern bioinformatic methods offer powerful tools for predicting functional domains and interaction sites in proteins like CC_3678, providing valuable guidance for experimental design:

Sequence-Based Prediction Methods:

  • Homology detection: Tools like BLAST, HHpred, and HMMER can identify distant homologs with known functions, providing clues about CC_3678's role.

  • Conservation analysis: Multiple sequence alignments of CC_3678 homologs from diverse species can reveal evolutionarily conserved residues likely to be functionally important. ConSurf and Rate4Site are useful for mapping conservation onto structural models.

  • Motif identification: PROSITE, SMART, and InterPro databases can detect functional motifs and domains within the sequence.

  • Disorder prediction: Tools like PONDR and IUPred can identify intrinsically disordered regions that might be involved in protein-protein interactions.

Structure-Based Prediction Methods:

Integrative Approaches:

  • Co-evolution analysis: Methods like Direct Coupling Analysis (DCA) and GREMLIN can detect pairs of residues that co-evolve, suggesting physical contact within or between proteins.

  • Network analysis: Integrating CC_3678 into protein-protein interaction networks of known septation proteins can highlight potential functional associations.

  • Phylogenetic profiling: Comparing the presence/absence of CC_3678 and other proteins across species can suggest functional relationships.

The results from these bioinformatic analyses should be integrated to develop testable hypotheses about CC_3678 function. Researchers should prioritize experimental validation of the most confident predictions, using techniques like site-directed mutagenesis to confirm the importance of predicted functional sites.

How can cryo-electron microscopy be optimized for studying the structure of membrane-associated CC_3678?

Cryo-electron microscopy (cryo-EM) has revolutionized structural biology of membrane proteins, but requires specific optimization for challenging targets like CC_3678:

Sample Preparation Optimization:

  • Detergent selection: Conduct systematic screening of detergents (DDM, LMNG, GDN) and amphipols to identify conditions that maintain CC_3678 stability while minimizing micelle size.

  • Membrane mimetic alternatives: Consider nanodiscs, liposomes, or styrene-maleic acid copolymer lipid particles (SMALPs) to maintain a more native-like lipid environment.

  • Protein engineering: Create constructs with minimized flexible regions or fusion proteins (e.g., with antibody fragments) to increase particle size and provide recognition features for image processing.

  • Vitrification parameters: Optimize blotting time, humidity, and temperature to achieve ideal ice thickness for membrane protein samples.

Data Collection Strategies:

  • Motion correction optimization: Implement dose-fractionation with frame alignment optimized for membrane proteins, which are particularly sensitive to beam-induced movement.

  • Contrast enhancement: Consider phase plates or energy filters to improve contrast of smaller membrane proteins.

  • Tilt series acquisition: For particularly challenging samples, implement tomographic approaches to improve particle orientation distribution.

  • High-resolution data collection: Use appropriately small pixel sizes (0.8-1.0 Å/pixel) and appropriate total dose (40-60 e-/Ų) distributed across multiple frames.

Image Processing Approaches:

  • 2D classification optimization: Implement approaches specifically designed for membrane proteins, with careful masking to focus on protein density while excluding micelle or nanodisc contributions.

  • 3D reconstruction strategies: Consider symmetry-based approaches if CC_3678 forms oligomers, or focus on local refinement of key domains.

  • Heterogeneity analysis: Implement 3D variability analysis or multi-body refinement to capture conformational dynamics relevant to function.

Researchers should be prepared for an iterative optimization process, with continuous refinement of sample preparation, data collection, and processing parameters. Collaboration with experienced cryo-EM specialists is highly recommended for membrane protein structural studies of this complexity.

What emerging technologies show promise for studying dynamic interactions of CC_3678 during bacterial cell division?

Several cutting-edge technologies are transforming our ability to study dynamic protein interactions during bacterial cell division, with particular relevance to CC_3678:

Advanced Imaging Technologies:

  • Super-resolution microscopy optimization: Techniques like PALM, STORM, and structured illumination microscopy (SIM) can be applied to visualize CC_3678 localization with nanometer precision. Recent adaptations for bacterial cells include modified sample preparation protocols to account for the small cell size and cell wall.

  • Lattice light-sheet microscopy: Provides exceptional spatial and temporal resolution for tracking protein dynamics in living cells with minimal phototoxicity, enabling long-term imaging of CC_3678 throughout multiple division cycles.

  • Expansion microscopy: Physical expansion of bacterial specimens can improve effective resolution of conventional microscopes, revealing previously undetectable spatial patterns of CC_3678 localization.

Real-time Interaction Monitoring:

  • FRET biosensors: Design protein conformation sensors based on CC_3678 to detect binding events or conformational changes during septation.

  • Split fluorescent protein systems: Optimized for bacterial expression, these can visualize protein-protein interactions with spatial and temporal resolution.

  • Optogenetic tools: Light-controlled protein interaction systems allow precise temporal manipulation of CC_3678 interactions to test functional hypotheses.

Single-cell Biochemical Analysis:

  • Mass spectrometry imaging: Emerging techniques for spatial proteomics at subcellular resolution could map CC_3678 distribution and modification state.

  • Single-cell proteomics: Quantify protein abundance variations across individual cells at different cell cycle stages.

  • Microfluidics-based approaches: Combine with live-cell imaging to correlate CC_3678 dynamics with cell division outcomes in controlled environments.

Computational Integration:

  • Machine learning-based image analysis: Automated tracking of protein localization patterns across thousands of cells to identify subtle phenotypes.

  • Integrative modeling: Combine structural information, interaction data, and dynamic measurements into predictive models of septation complex assembly.

Researchers should consider implementing complementary approaches from these categories to build a comprehensive understanding of CC_3678's dynamic behavior during bacterial cell division. Early adoption of these emerging technologies could provide significant competitive advantages in understanding the mechanistic details of septation.

What are the key unresolved questions about CC_3678 that warrant further investigation?

Despite progress in characterizing CC_3678, several fundamental questions remain unanswered and represent priorities for future research:

Structural and Functional Unknowns:

  • Precise molecular function: While predicted to be involved in septation, the exact molecular mechanisms through which CC_3678 contributes to this process remain unclear. Does it have enzymatic activity, act as a scaffold, or serve primarily as a structural component?

  • Regulatory mechanisms: How is CC_3678 activity regulated during the cell cycle? Are post-translational modifications, protein-protein interactions, or changes in subcellular localization involved in modulating its function?

  • Structural dynamics: How does the three-dimensional structure of CC_3678 change during septation, and how do these conformational changes relate to its function?

Biological Context Questions:

  • Evolutionary conservation: To what extent are CC_3678's functions conserved across different bacterial species, and what can this tell us about its fundamental role in bacterial physiology?

  • Redundancy and essentiality: Is CC_3678 essential for Caulobacter crescentus viability, or are there redundant mechanisms that can compensate for its absence under certain conditions?

  • Environmental adaptation: How does CC_3678 function respond to different environmental stresses, and does it play a role in bacterial adaptation?

Methodological Challenges:

  • In situ structural characterization: Developing methods to study the structure and dynamics of CC_3678 within its native cellular environment remains a significant challenge.

  • Functional reconstitution: Establishing in vitro systems that accurately recapitulate CC_3678's in vivo functions would provide powerful tools for mechanistic studies.

Addressing these questions will require integrated approaches combining advanced structural biology, genetic manipulation, biochemical characterization, and cellular imaging. Progress in this area could provide fundamental insights into bacterial cell division mechanisms with potential implications for antimicrobial development and synthetic biology applications.

How might research on CC_3678 contribute to broader understanding of bacterial cell division mechanisms?

Research on CC_3678 has the potential to significantly advance our understanding of bacterial cell division mechanisms in several important ways:

Fundamental Cell Biology Insights:

  • Diversity in division mechanisms: Comparing CC_3678's role in Caulobacter with septation proteins in other bacterial species can highlight both conserved fundamental processes and species-specific adaptations in cell division.

  • Coordination of division events: Understanding how CC_3678 integrates with other division components could reveal principles governing the precise temporal and spatial regulation of bacterial cytokinesis.

  • Membrane-cytoskeleton interactions: As a probable membrane-associated septation protein, CC_3678 may illuminate how membrane remodeling coordinates with cytoskeletal elements during division.

Evolutionary Perspectives:

  • Evolutionary relationships: Comparative analyses of CC_3678 homologs across diverse bacterial phyla can provide insights into the evolution of cell division machinery.

  • Specialization in asymmetric division: Caulobacter's distinctive asymmetric division process makes CC_3678 particularly interesting for understanding how bacteria achieve differential daughter cell fates.

Translational Potential:

  • Antimicrobial development: Identifying essential roles for CC_3678 in cell division could highlight novel targets for antimicrobial development, particularly valuable given the distinctive features of alpha-proteobacterial cell division.

  • Synthetic biology applications: Understanding the molecular details of CC_3678 function could enable engineering of modified bacterial division processes for biotechnological applications.

  • Methodological advances: Technical challenges overcome during CC_3678 research may drive broader methodological innovations for studying membrane proteins and dynamic protein complexes.

By focusing detailed mechanistic studies on specific components like CC_3678, researchers can build toward a more comprehensive systems-level understanding of bacterial cell division. This protein represents an important piece in the complex puzzle of how bacteria coordinate the multiple molecular events required for successful reproduction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.