Recombinant Caulobacter crescentus Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
htpX; CCNA_02594; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Caulobacter crescentus (strain NA1000 / CB15N)
Target Names
htpX
Target Protein Sequence
MNHFKTYMLLAGLTALFMGAGFLIGGATGMMIALVFALAMNAFSYWNADKIVLRTYGAVE VDESHPEPLIRNYVIDTVEMARSAGLPRPRITVIDSAQPNAFATGRDPDHAAVAASTGLL QLLTREEIRGVMAHELAHVKNRDTLVMTVTATIAGAISALANFAFFFGGSRDEEGNGGGL GGMIGAILIAILAPIAAMLVQMAISRAREYEADRIGAQIAGDSESLARALQKIEAYARGG YENVQAERNPATAHMFIINPLAGKGADNLFSTHPATHNRVEALMRLGVERGARRPVMAAT TSSSVPLSGERGGPWS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Caulobacter crescentus Protease HtpX homolog and what is its fundamental role in cellular function?

The Caulobacter crescentus Protease HtpX homolog belongs to the M48 family of zinc metalloproteinases and is primarily involved in membrane protein quality control. Similar to its Escherichia coli counterpart, it plays a crucial role in the degradation of misfolded or damaged membrane proteins that could otherwise compromise membrane integrity and function . The full-length protein consists of 309 amino acids and contains multiple hydrophobic regions that likely function as transmembrane segments .

HtpX is an integral membrane protein that contributes to cellular proteostasis by eliminating malfolded and/or misassembled membrane proteins that could disrupt membrane structure and function. This quality control mechanism is essential for maintaining normal cellular activities, particularly under stress conditions .

How is the Recombinant HtpX typically expressed and purified for research applications?

For research applications, Recombinant Caulobacter sp. Protease HtpX homolog (htpX) is typically expressed in E. coli expression systems with an N-terminal His-tag for purification purposes . The full-length protein (1-309aa) contains the complete amino acid sequence and demonstrates protease activity when properly folded.

The recombinant protein is commonly supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . For reconstitution, researchers should:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol (typically to a final concentration of 50%) before aliquoting for long-term storage

  • Store aliquots at -20°C/-80°C and avoid repeated freeze-thaw cycles

Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing significantly diminishes protein activity .

What experimental systems are available for studying HtpX protease activity?

Researchers have developed several experimental systems for studying HtpX protease activity:

  • In vivo semiquantitative assay systems: These allow for convenient detection of HtpX protease activity within living cells. Such systems involve the construction of model substrates specifically designed for HtpX .

  • Differential protease activity detection: These systems can detect variations in protease activities among different HtpX mutants, particularly those carrying mutations in conserved regions .

  • Stress-response monitoring: Since HtpX expression is increased under stress conditions such as heat shock and oxidative stress, monitoring these responses provides insights into HtpX function .

These experimental approaches enable researchers to investigate not only the functions of HtpX in Caulobacter crescentus but also its homologs in other bacteria, providing comparative data on functional conservation across species .

How does HtpX expression change under different stress conditions, and what are the implications for experimental design?

HtpX expression exhibits significant variations under different stress conditions, which has important implications for experimental design. In Pyrococcus furiosus, increased HtpX transcript levels were detected under heat shock conditions . Similarly, in Haloferax volcanii, elevated protein abundance of HtpX was observed during oxidative stress . These findings suggest that HtpX plays a crucial role in cellular stress responses across different prokaryotic domains.

When designing experiments to study HtpX function, researchers should consider:

  • Stress condition selection: Different stressors may induce varying levels of HtpX expression. Heat shock protocols typically involve temperature increases of 10-15°C above optimal growth temperature for 15-30 minutes. Oxidative stress can be induced with sub-lethal concentrations of H₂O₂ or paraquat.

  • Time-course analysis: HtpX expression kinetics may vary depending on the type and duration of stress. Time-point sampling should range from immediate (0-15 minutes) to extended (several hours) post-stress induction.

  • Baseline expression control: Always include non-stressed control samples to determine baseline expression levels for accurate comparative analysis.

  • Cross-stress analysis: Testing multiple stressors may reveal stress-specific or general stress response pathways involving HtpX.

These considerations ensure that experimental conditions properly capture the physiologically relevant contexts in which HtpX functions .

How can model substrates be designed to assess HtpX proteolytic activity in various experimental settings?

Designing effective model substrates is crucial for studying HtpX proteolytic activity. Based on recent advances in HtpX research, the following methodological approach is recommended:

  • Substrate selection criteria:

    • Include recognition motifs known to be targeted by HtpX

    • Incorporate transmembrane segments that mimic natural substrates

    • Add reporter tags that facilitate detection of cleavage products

  • Construction of HtpX model substrates:
    Researchers have successfully established model substrates (such as XMS1) that allow for semiquantitative and convenient protease activity assessment . The essential components include:

    • A fusion protein with detectable N-terminal and C-terminal domains

    • A central region containing the HtpX recognition sequence

    • Reporter tags (such as GFP variants) that enable measurement of cleavage products

  • Detection methods:

    • Western blotting using antibodies against the terminal tags

    • Fluorescence-based detection if fluorescent proteins are incorporated

    • Mass spectrometry to precisely identify cleavage sites

  • Experimental conditions optimization:

    • Expression level calibration to prevent substrate overload

    • Time-course analysis to determine kinetics of cleavage

    • Temperature and pH optimization based on the organism of study

This approach enables detection of differential protease activities among HtpX variants, particularly those with mutations in conserved regions, facilitating structure-function analyses .

What is the recommended protocol for conducting in vivo HtpX protease activity assays?

The following protocol is based on established methodologies for assessing HtpX protease activity in vivo:

  • Construction of model substrate:

    • Design a fusion protein containing an HtpX recognition sequence

    • Include reporter tags (such as His-tag, Myc-tag, or fluorescent proteins) for detection

    • Clone the construct into an appropriate expression vector

  • Expression system preparation:

    • Transform the construct into appropriate bacterial strains (wild-type, htpX-deletion, or htpX-mutant)

    • Culture transformants under standard conditions until mid-log phase

  • Stress induction (if applicable):

    • Subject cultures to relevant stress conditions (heat shock, oxidative stress)

    • Collect samples at determined time points

  • Sample processing:

    • Harvest cells and prepare membrane fractions

    • Separate proteins by SDS-PAGE

    • Detect cleaved products using Western blotting with tag-specific antibodies

  • Data analysis:

    • Quantify band intensities to determine the extent of proteolysis

    • Calculate proteolytic efficiency by comparing cleaved product to uncleaved substrate

    • Compare activities between wild-type and mutant variants

This semiquantitative and convenient protease activity assay system enables detection of differential protease activities among HtpX variants, facilitating structure-function analyses and comparative studies across species .

What are the critical factors to consider when interpreting HtpX expression data across different organisms?

When interpreting HtpX expression data across different organisms, researchers should consider several critical factors:

  • Evolutionary conservation:
    HtpX homologs have been identified in diverse organisms including Caulobacter sp., Escherichia coli, Pyrococcus furiosus, and Haloferax volcanii . While the core function in membrane protein quality control appears conserved, species-specific adaptations may exist.

  • Expression context differences:

    • In Pyrococcus furiosus, HtpX transcript levels increase under heat shock

    • In Haloferax volcanii, HtpX protein abundance increases during oxidative stress

    • In E. coli, HtpX has been implicated in general membrane protein quality control

  • Functional redundancy:
    Multiple HtpX homologs may exist within a single organism. For example, three HtpX homologs (HVO_0102, HVO_2904, and HVO_A0045) were detected in the Haloferax volcanii proteome . This redundancy may affect the interpretation of knockout studies.

  • Regulatory network integration:
    HtpX expression may be influenced by the presence or absence of other proteases. For instance, increased abundance of HVO_A0045 (an HtpX homolog) was observed in a strain lacking the rhomboid homolog RhoII, suggesting compensatory mechanisms within the proteolytic network .

  • Methodological considerations:

    • Transcriptomic versus proteomic data may show discrepancies

    • Growth phase affects expression levels

    • Extraction methods may introduce biases for membrane proteins

When comparing data across studies, researchers should standardize experimental conditions as much as possible and consider the physiological context of each organism.

What is the relationship between HtpX and other proteolytic systems such as ClpXP in Caulobacter crescentus?

The relationship between HtpX and other proteolytic systems in Caulobacter crescentus reveals a complex network of protein quality control mechanisms:

  • Complementary compartmentalization:

    • HtpX operates primarily at the membrane level, targeting misfolded or damaged membrane proteins

    • ClpXP functions predominantly in the cytoplasm, although it can also degrade membrane-associated proteins

  • Stress response coordination:
    Both proteolytic systems are implicated in stress responses, but they may be activated under different conditions or with different kinetics:

    • HtpX is typically upregulated during heat shock and oxidative stress

    • ClpXP is essential in Caulobacter crescentus, unlike in Escherichia coli where it is dispensable

  • Substrate specificity:

    • HtpX targets specific membrane proteins with particular recognition motifs

    • ClpXP in Caulobacter is known to partially process the DnaX protein, creating functional diversity from a single gene product

  • Developmental regulation:
    In Caulobacter crescentus, proteolytic systems play crucial roles in cell cycle progression and development:

    • ClpXP is essential for viability and proper DNA-damage response

    • The specific role of HtpX in developmental processes requires further investigation

  • Potential functional overlap:
    While these systems generally target different substrate pools, there may be some functional redundancy or sequential processing of certain substrates.

This relationship underscores the intricate coordination of proteolytic systems in maintaining cellular homeostasis in Caulobacter crescentus. Further research is needed to fully characterize the interplay between HtpX and other proteases in this organism .

How can comparative studies of HtpX across different bacterial species inform our understanding of membrane protein quality control?

Comparative studies of HtpX across bacterial species provide valuable insights into evolutionary conservation and divergence of membrane protein quality control mechanisms:

  • Conservation of core function:
    The fundamental role of HtpX in membrane protein quality control appears to be conserved across diverse bacterial species and even extends to archaea . This conservation suggests a critical and ancient function in cellular homeostasis.

  • Adaptation to ecological niches:
    Different bacterial species inhabit varied environments, each with unique stressors:

    • Thermophiles like Pyrococcus furiosus face extreme temperature challenges

    • Halophiles like Haloferax volcanii must contend with osmotic stress

    • Caulobacter crescentus adapts to nutrient-poor aquatic environments

    Studying how HtpX functions across these diverse organisms can reveal specialized adaptations in membrane protein quality control mechanisms.

  • Methodological approaches:
    Comparative studies should include:

    • Sequence alignment and structural prediction to identify conserved domains

    • Heterologous expression to test functional complementation

    • Creation of chimeric proteins to identify species-specific functional domains

    • Analysis of substrate specificity across species

  • Research implications:
    Such comparative studies have practical applications in:

    • Identifying universal targets for antimicrobial development

    • Understanding bacterial adaptation to environmental stresses

    • Elucidating fundamental principles of membrane protein homeostasis

By establishing an in vivo protease activity assay system for HtpX that works across species, researchers can systematically compare HtpX function in different organisms, contributing to a comprehensive understanding of membrane protein quality control mechanisms .

What are the most promising research directions for understanding HtpX function in prokaryotic stress responses?

Several promising research directions could significantly advance our understanding of HtpX function in prokaryotic stress responses:

  • Comprehensive substrate identification:
    Despite its importance, the physiological substrates of HtpX remain largely unidentified. Future research should focus on:

    • Proteomics approaches comparing membrane proteomes in wild-type versus htpX-deletion strains under various stress conditions

    • Development of substrate trapping mutants that bind but do not cleave targets

    • Global analysis of membrane protein turnover rates in the presence and absence of HtpX

  • Stress-specific regulation mechanisms:
    Evidence suggests that HtpX expression and activity are regulated in response to specific stresses . Key research questions include:

    • What transcriptional and post-transcriptional mechanisms control HtpX expression?

    • How is HtpX activity modulated at the protein level under different stress conditions?

    • Are there stress-specific co-factors that influence HtpX function?

  • Structural biology approaches:
    Obtaining high-resolution structures of HtpX would significantly advance our understanding of:

    • Substrate recognition mechanisms

    • Catalytic mechanism of proteolysis

    • Membrane topology and dynamics

    • Potential conformational changes under stress conditions

  • Integration with other proteolytic systems:
    HtpX likely functions within a broader network of proteolytic quality control:

    • Investigate potential sequential or cooperative processing with other proteases like ClpXP

    • Examine compensatory mechanisms when one proteolytic system is compromised

    • Map the complete membrane protein quality control network

  • Evolutionary perspectives:
    Comparing HtpX function across the three domains of life could reveal:

    • Ancient conserved mechanisms of membrane protein quality control

    • Lineage-specific adaptations

    • Potential horizontal gene transfer events

These research directions would provide a more comprehensive understanding of HtpX's role in prokaryotic stress responses and could inform strategies for modulating bacterial stress resistance in various applications .

What are the common technical challenges in working with recombinant HtpX and how can they be addressed?

Working with recombinant HtpX presents several technical challenges due to its nature as a membrane-associated zinc metalloproteinase. Here are the most common issues and recommended solutions:

  • Protein solubility and stability:

    Challenge: As a membrane protein, HtpX has hydrophobic regions that can cause aggregation during expression and purification.

    Solutions:

    • Use detergents compatible with membrane proteins (n-dodecyl β-D-maltoside, digitonin, or CHAPS)

    • Express at lower temperatures (16-20°C) to slow folding and reduce aggregation

    • Include stabilizing agents such as glycerol (6-50%) in storage buffers

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL concentration

    • Store working aliquots at 4°C for no more than one week

  • Maintaining enzymatic activity:

    Challenge: HtpX activity can be significantly reduced by improper handling.

    Solutions:

    • Avoid repeated freeze-thaw cycles

    • Include zinc in buffers (typically 10-50 μM ZnCl₂) to maintain the active site

    • Use freshly prepared aliquots for activity assays

    • Validate activity with established model substrates

  • Expression system selection:

    Challenge: Obtaining sufficient quantities of properly folded, active HtpX.

    Solutions:

    • E. coli is the preferred expression system for recombinant Caulobacter HtpX

    • Consider membrane-targeted expression systems for improved folding

    • Use fusion tags (His-tag) for purification while minimizing interference with activity

    • Optimize codon usage for the expression host

  • Purification challenges:

    Challenge: Obtaining pure, homogeneous preparations.

    Solutions:

    • Two-step purification combining affinity chromatography and size exclusion

    • Verify purity by SDS-PAGE (aim for >90% purity)

    • Use buffer exchange rather than dialysis to minimize protein loss

  • Activity assay development:

    Challenge: Establishing reliable activity measurements.

    Solutions:

    • Develop model substrates with appropriate recognition sequences

    • Include both in vitro and in vivo assay systems

    • Use semiquantitative detection methods for comparative analyses

By addressing these technical challenges systematically, researchers can improve the quality and reliability of their experiments with recombinant HtpX.

How can researchers effectively design mutation studies to investigate structure-function relationships in HtpX?

Designing effective mutation studies for HtpX requires careful consideration of structural elements, functional domains, and appropriate experimental readouts. The following methodological approach is recommended:

  • Target selection for mutagenesis:

    Priority targets:

    • The HEXXH zinc-binding motif essential for metalloprotease activity

    • Conserved residues identified through multiple sequence alignments of HtpX homologs

    • Hydrophobic regions that may function as transmembrane segments

    • Putative substrate recognition sites

    • Residues potentially involved in protein-protein interactions

  • Mutation strategy:

    Systematic approaches:

    • Alanine scanning: Replace individual residues with alanine to identify essential amino acids

    • Conservative substitutions: Replace with biochemically similar residues to fine-tune functional analysis

    • Domain swapping: Exchange domains between HtpX homologs from different species

    • Truncation analysis: Create systematic deletions to identify minimal functional units

  • Expression and analysis systems:

    Experimental setup:

    • Express mutants in htpX-deletion backgrounds to eliminate interference from endogenous protein

    • Use established model substrates and assay systems to measure activity

    • Employ the semiquantitative in vivo protease activity assay system to detect differential activities

    • Include appropriate controls (wild-type and catalytically inactive mutants)

  • Comprehensive phenotypic analysis:

    Measurements to include:

    • Proteolytic activity using model substrates

    • Membrane localization and topology

    • Protein stability and expression levels

    • Stress response phenotypes (heat shock, oxidative stress)

    • Growth characteristics under various conditions

  • Structural analysis integration:

    Connecting mutations to structure:

    • Use homology modeling based on related proteases with known structures

    • Interpret mutational effects in the context of predicted structural features

    • Consider cooperative effects between residues in spatial proximity

This systematic approach to mutation studies will facilitate the identification of key structural features that determine HtpX function and substrate specificity, advancing our understanding of this important membrane protease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.