Recombinant Caulobacter crescentus Uncharacterized protein CC_3663 (CC_3663)

Shipped with Ice Packs
In Stock

Description

Protein Overview

CC_3663 is an uncharacterized protein encoded by the CC_3663 gene in Caulobacter crescentus (strain ATCC 19089/CB15). The recombinant form is expressed in Escherichia coli with a His tag for purification . Key attributes include:

  • UniProt ID: Q9A2A3

  • Gene locus: CC_3663

  • Sequence: Full-length (1–250 amino acids) .

Production and Purification

Recombinant CC_3663 is produced under optimized conditions:

ParameterDetail
Expression HostE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
StorageTris/PBS buffer with 6% trehalose (pH 8.0); lyophilized or at -80°C
ReconstitutionSterile deionized water (0.1–1.0 mg/mL) with optional 50% glycerol

Potential Research Applications

While CC_3663’s role in C. crescentus physiology is unknown, its recombinant form is utilized in:

  • ELISA development: For antibody validation or biomarker studies .

  • Structural biology: To investigate membrane protein folding or interactions.

  • Functional genomics: As a candidate for knock-out/knock-in studies to elucidate its cellular role.

Limitations and Future Directions

No peer-reviewed studies directly investigating CC_3663’s function or interactions were identified. Further work is required to:

  • Characterize its enzymatic or structural role in C. crescentus.

  • Validate its interaction partners using techniques like yeast two-hybrid screening.

  • Explore homologs in related species for evolutionary insights.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C. Aliquot the solution for optimal storage. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
CC_3663; Uncharacterized protein CC_3663
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Caulobacter crescentus (strain ATCC 19089 / CB15)
Target Names
CC_3663
Target Protein Sequence
MNDFNRGYARSIPADRADMSVDAGLRKFMLGVYNKVALGLVVSGALAYATSSVPAVRDLL FVVQGGRLAGVTPLYMVVAFAPLVLMLIAGFAMRNPKPETAGALYWTIVSLIGASLGSVM LRYTGESVAATFFVTATAFGGLSLFGYTTKKDLTGFGSFLMMGVIGLIVASIVSIFLKSP ALLFAINVLGVLIFSGLIAYDTQRLKMTYYEMGGDRASMAVATNFGALSLYINFINLFQF LLSFFGGNRE
Uniprot No.

Target Background

Database Links

KEGG: ccr:CC_3663

STRING: 190650.CC_3663

Protein Families
BI1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the structure and sequence of Uncharacterized protein CC_3663?

The CC_3663 protein from Caulobacter crescentus (strain ATCC 19089 / CB15) consists of 250 amino acids with a sequence characterized by several distinct regions. The primary sequence (MNDFNRGYARSIPADRADMSVDAGLRKFMLGVYNKVALGLVVSGALAYATSSPAVRDLLFVVQGGRLAGVTPLYMVVAFAPLVLMLIAGFAMRNPKPETAGALYWTIVSLGASLGSVMLRYTGESVAATFFVTATAFGGLSLFGYTTKKDLTGFGSFLMMGVIGLIVASIVSIFLKSPALLFAINVLGVLIFSGLIAYDTQRLKMTYYEMGGDRASMAVATNFGALSLYINFINLFQFLLSFFGGNRE) suggests several transmembrane domains . Bioinformatic analysis indicates CC_3663 is likely a membrane-associated protein, containing hydrophobic regions consistent with transmembrane helices. The protein has been classified as "uncharacterized," indicating that its precise function has not been experimentally determined despite its complete sequencing. As with many uncharacterized proteins in bacterial systems, structural predictions based on amino acid composition suggest potential functional domains, but these require experimental validation through techniques such as X-ray crystallography or NMR spectroscopy.

How does CC_3663 compare to other characterized membrane proteins in Caulobacter crescentus?

While direct comparative data for CC_3663 is limited, analysis can be performed by examining other characterized C. crescentus membrane proteins like those involved in signaling pathways. Unlike the well-characterized c-di-GMP signaling proteins such as CC3396 (a GGDEF-EAL composite protein with phosphodiesterase activity) , CC_3663 lacks the recognizable GGDEF or EAL domains associated with c-di-GMP metabolism. The amino acid sequence of CC_3663 shares some similarities with membrane transport proteins, containing multiple predicted transmembrane segments that could facilitate molecular transport across the cell membrane . Unlike the CdzC and CdzD proteins involved in contact-dependent inhibition systems in C. crescentus, CC_3663 does not contain the characteristic glycine-zipper motifs often found in bacteriocin-like proteins . Additionally, CC_3663 does not appear to possess the type I secretion signal sequences found in proteins exported via type I secretion systems like the CdzAB system characterized in C. crescentus .

What experimental designs are most appropriate for characterizing the function of CC_3663?

A comprehensive experimental approach for characterizing CC_3663 should employ a completely randomized design (CRD) when testing expression conditions, combined with factorial experiments to examine multiple variables simultaneously . The experimental design should include the following components: expression analysis across multiple growth phases to determine temporal regulation patterns; knockout or knockdown studies to assess phenotypic changes; localization studies using fluorescent protein fusions; and protein-protein interaction studies using techniques such as co-immunoprecipitation or bacterial two-hybrid systems. When designing these experiments, researchers should carefully consider the formulation of statistical hypotheses that directly address the scientific questions regarding CC_3663 function . The determination of experimental conditions should include independent variables (such as growth conditions, stress factors, or genetic backgrounds), dependent variables (protein expression levels, cell phenotypes), and controlling for nuisance variables (temperature fluctuations, media batch variations) .

Experimental ApproachDesign TypeStatistical AnalysisControls Required
Expression AnalysisTime-course CRDANOVA, regression analysisHousekeeping gene expression
Knockout StudiesCRD or RBDANOVA with factorial structureWild-type strain, complementation
Localization StudiesCRDQuantitative image analysisEmpty vector, known localization markers
Protein InteractionCRDStatistical significance of interactionsNon-specific binding controls

How should statistical analysis be structured for CC_3663 characterization experiments?

For rigorous characterization of CC_3663, statistical analysis should follow established principles of experimental design and ANOVA. According to experimental design principles, the analysis of variance technique introduced by Sir Ronald A. Fisher is essentially an arithmetic process for partitioning a total sum of squares into components associated with recognized sources of variation . When designing CC_3663 experiments with multiple treatment conditions, researchers should first perform standard ANOVA considering all treatments without factoring in the experimental structure, followed by factorial analysis excluding any additional treatments . This approach enables researchers to contrast additional treatments with the factorial experiment and determine if their means differ significantly through the F test. The appropriate R packages for analysis include the basic 'stats' package containing standard functions like lm() and aov(), as well as specialized packages like 'ExpDes' developed at the Federal University of Alfenas specifically for ANOVA analysis in experimental designs . When analyzing complex experiments involving CC_3663, such as those examining expression under various environmental conditions, researchers should carefully specify the number of subjects required, the population from which they will be sampled, and the procedure for assigning subjects to experimental conditions .

What protein purification approaches are recommended for recombinant CC_3663?

The purification of recombinant CC_3663 presents several challenges due to its predicted membrane-associated nature. Based on its amino acid sequence and predicted transmembrane domains, purification protocols should incorporate detergent-based extraction methods similar to those used for other membrane proteins in C. crescentus . Initial extraction should utilize a Tris-based buffer system with mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) to solubilize the protein while maintaining its native conformation. For storage, a buffer containing 50% glycerol has been shown to be effective for maintaining protein stability, as indicated in the product information for commercially available recombinant CC_3663 . When expressing recombinant CC_3663, researchers should consider adding affinity tags that can be determined during the production process to facilitate purification while minimizing interference with protein function . For long-term storage, purified CC_3663 should be stored at -20°C or -80°C, with working aliquots maintained at 4°C for up to one week to avoid degradation from repeated freeze-thaw cycles .

What approaches can determine if CC_3663 plays a role in cellular signaling pathways?

To investigate whether CC_3663 participates in cellular signaling pathways similar to other C. crescentus membrane proteins, researchers should employ a multi-faceted approach incorporating expression analysis, mutant phenotyping, and biochemical characterization. Expression analysis should examine whether CC_3663 is differentially regulated during growth phases, similar to how the CdzC and CdzD proteins are highly upregulated as cells enter stationary phase when cell density increases and nutrients become scarce . This could involve RNA-Seq to compare global patterns of gene expression or epitope tagging of CC_3663 to monitor protein levels through western blotting across different growth conditions. Genetic approaches should include constructing knockout mutants and examining phenotypic changes, particularly during stationary phase transitions when many signaling systems become active. Researchers should also investigate potential connections to known signaling networks such as the c-di-GMP pathway by examining whether CC_3663 expression or activity is affected in mutants of key c-di-GMP signaling components . Biochemical assays should test for potential enzymatic activities, such as those involving nucleotide binding or hydrolysis, similar to the approaches used to characterize the GGDEF-EAL domain protein CC3396, which was shown to have phosphodiesterase activity dependent on GTP binding .

How might CC_3663 be involved in cell-cell interactions or contact-dependent processes?

Given recent discoveries about contact-dependent inhibition systems in Caulobacter crescentus, investigating whether CC_3663 participates in similar processes represents an advanced research direction. Recent research has identified a novel two-protein bacteriocin system (CdzC/CdzD) in C. crescentus that mediates cell contact-dependent killing, wherein the bacteriocin-like proteins form large, insoluble aggregates on the surface of producer cells that can drive contact-dependent killing of other organisms . To investigate possible involvement of CC_3663 in similar processes, researchers should first examine subcellular localization using fluorescent protein fusions or immunofluorescence microscopy to determine if CC_3663 is present at the cell surface. Co-culture experiments similar to those performed with the Cdz system could be designed, where wild-type and ΔCC_3663 strains are mixed to assess competitive fitness or inhibitory effects on neighboring cells . Interaction studies should examine whether CC_3663 forms aggregates or complexes with other proteins at the cell surface, potentially through chemical crosslinking followed by mass spectrometry. Additionally, researchers should test for immunity functions by expressing CC_3663 in potentially susceptible strains to determine if it provides protection against known contact-dependent inhibition systems identified in C. crescentus or related species .

What bioinformatic approaches best predict potential functions of CC_3663?

Given the uncharacterized nature of CC_3663, sophisticated bioinformatic analyses represent a crucial approach for generating testable hypotheses about protein function. Unlike traditional BLAST searches that may not identify remote homologs, researchers should employ hidden Markov model (HMM) profiling similar to the approach used to identify Cdz-like systems in bacterial genomes . This would involve constructing a database of proteins with similar genomic context and then evaluating them using iterative HMM searches to identify subtle sequence patterns that might suggest functional similarities. Researchers should analyze CC_3663 for characteristics such as predicted secretion leader peptides, glycine-zipper motifs, or charged C-terminal regions that could indicate functional parallels to known bacterial systems . Structural prediction tools like AlphaFold or RoseTTAFold should be employed to generate structural models that can be compared against known protein folds. Analysis of genomic context should examine whether CC_3663 is co-transcribed with other genes that might provide functional clues, similar to how the CdzC/D proteins were found to be co-transcribed with a type I secretion system and an immunity protein . Additionally, researchers should examine expression correlation networks using publicly available transcriptomic data to identify genes with similar expression patterns that might participate in shared biological processes.

How should researchers analyze and interpret contradictory results in CC_3663 studies?

When facing contradictory results in studies of uncharacterized proteins like CC_3663, researchers should implement systematic troubleshooting and analysis approaches. The first step involves meticulous examination of experimental conditions and variables that might explain discrepancies, applying principles of experimental design to identify potential confounding factors . Researchers should consider performing factorial experiments that can simultaneously examine multiple variables and their interactions, enabling a more comprehensive understanding of the conditions influencing CC_3663 activity or expression . Statistical approaches should include analysis of variance to partition the total sum of squares into components associated with recognized sources of variation, helping to identify which experimental factors significantly contribute to observed differences . When contradictory results emerge from different experimental approaches, researchers should evaluate the underlying assumptions of each technique and potential limitations that might affect interpretation. For instance, if functional predictions based on sequence analysis contradict experimental observations, researchers might need to consider post-translational modifications, protein-protein interactions, or environmental factors that could modulate protein function beyond what the primary sequence suggests .

Source of ContradictionAnalysis ApproachResolution Strategy
Different expression conditionsFactorial ANOVAIdentify significant variables affecting expression
Conflicting localization dataSample preparation analysisOptimize fixation/imaging protocols
Function prediction vs. observationPathway analysisExamine context-dependent regulation
Strain-specific differencesGenomic analysisCompare genetic backgrounds thoroughly

What statistical considerations are essential when analyzing protein-protein interaction data for CC_3663?

When analyzing protein-protein interaction data for CC_3663, researchers must apply rigorous statistical frameworks to distinguish between genuine biological interactions and experimental artifacts. Experimental designs should follow randomized block designs (RBD) or completely randomized designs (CRD) depending on the specific interaction assay employed . For co-immunoprecipitation experiments, statistical analysis should include quantification of protein amounts across multiple biological replicates with appropriate controls for non-specific binding. When applying techniques like bacterial two-hybrid systems, researchers should implement the statistical analysis recommended by Fisher, which involves partitioning the total sum of squares into components associated with recognized sources of variation . This approach helps distinguish between weak but genuine interactions and random noise in the experimental system. For high-throughput interaction studies, researchers should consider implementing false discovery rate corrections to account for multiple hypothesis testing. When designing experiments to validate computational predictions about CC_3663 interactions, researchers should specify the number of experimental units required based on power analysis and clearly define the population from which samples will be drawn . Additionally, when interpreting interaction data in relation to potential functional roles of CC_3663, researchers should consider the statistical significance of observed phenotypes in mutant strains using appropriate ANOVA models that can handle the factorial nature of biological experiments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.