Recombinant Caulobacter sp. ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Caul_4380; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Caulobacter sp. (strain K31)
Target Names
atpF
Target Protein Sequence
MPAFFEGEFWQIANPELWVGVGLILFIAIVIWAKAPAMIAGKLDETAAKIQTDLDEAARI RAEAEALLATIRAEREETERQAIAMLAAAKADVAQMEIEAKAKLEDQIKRRAEMAERKIA QSEAQAQADVKAAAVDLAAQIAEQVLMARLAAGGSDGLVDTAIGQIGAKLQ
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, encompassing the membrane proton channel. These domains are linked via a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) in Caulobacter species?

ATP synthase subunit b (atpF) is a critical component of the F0 sector of the ATP synthase complex in Caulobacter species. According to product information, it is also known as "ATP synthase F(0) sector subunit b," "ATPase subunit I," or "F-type ATPase subunit b" . The protein has a UniProt accession number of B0T010 and functions as part of the membrane-embedded portion of the ATP synthase machinery that facilitates proton translocation across the membrane, driving ATP synthesis.

What are the optimal storage conditions for recombinant atpF protein?

Proper storage of recombinant proteins is critical for maintaining their structural integrity and biological activity. For recombinant Caulobacter sp. ATP synthase subunit b:

FormStorage TemperatureShelf Life
Liquid-20°C/-80°C6 months
Lyophilized-20°C/-80°C12 months

For reconstitution, it is recommended to centrifuge the vial briefly before opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (final concentration) is recommended for long-term storage. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

How is the purity of recombinant atpF typically assessed?

The purity of recombinant Caulobacter sp. ATP synthase subunit b is typically assessed using SDS-PAGE, with commercial preparations generally achieving >85% purity . This analytical technique separates proteins based on their molecular weight, allowing researchers to evaluate both purity and potential degradation products. When designing experiments with this protein, researchers should consider the impact of minor contaminants on experimental outcomes, particularly for sensitive functional assays.

What experimental design approaches are most effective for studying ATP synthase activity?

When studying ATP synthase activity, a well-structured experimental design is essential. Based on established research methodologies, effective approaches include:

  • Clearly define variables:

    • Independent variables: protein variants (wild-type vs. mutants), environmental conditions (pH, temperature, ion concentrations)

    • Dependent variables: ATP synthesis/hydrolysis rates, proton pumping efficiency

    • Extraneous variables to control: temperature fluctuations, contaminating ATPases, buffer composition

  • Formulate testable hypotheses:

    • Null hypothesis (H0): "There is no difference in activity between conditions"

    • Alternative hypothesis (H1): "Treatment X affects ATP synthase activity"

  • Implement appropriate controls:

    • Positive controls (known functional ATP synthase)

    • Negative controls (heat-inactivated enzyme, known inhibitors)

    • Vehicle controls when using solvents or carriers

Researchers should select measurement techniques appropriate to their specific research questions, such as colorimetric ATP production assays, bioluminescence methods, or proton translocation measurements using pH-sensitive dyes.

How can researchers effectively reconstitute recombinant atpF for functional studies?

Reconstitution of functional ATP synthase components requires careful attention to protein handling:

  • Begin with high-purity recombinant atpF protein (>85% by SDS-PAGE)

  • Reconstitute protein in deionized sterile water to 0.1-1.0 mg/mL

  • For membrane protein studies, consider reconstitution in liposomes using appropriate lipid compositions

  • When studying subunit interactions, additional ATP synthase components may need to be co-reconstituted

  • Validate proper folding using circular dichroism or other structural techniques prior to functional assays

Each reconstitution step should be optimized and validated to ensure the protein maintains its native conformation and functional properties.

How does phosphorylation affect ATP synthase function and what methods can detect these modifications?

Post-translational modifications, particularly phosphorylation, can significantly impact ATP synthase function. Research on F1F0 ATP synthase β subunit phosphorylation revealed that:

  • Phosphorylation at specific residues can distinctly affect both enzymatic activity and complex assembly

  • The T262 site was particularly critical - phosphomimetic mutations (T262E) abolished ATPase activity while non-phosphorylatable mutations (T262A) maintained normal function

  • Phosphomimetic mutations at T58 altered the formation/maintenance of ATP synthase dimers and reduced (but did not eliminate) ATPase activity

Methods to study phosphorylation in ATP synthase components include:

MethodApplicationAdvantagesLimitations
Phosphomimetic mutationsFunctional studiesSimulates permanent phosphorylationMay not perfectly mimic phosphorylation
Mass spectrometryIdentification of phosphositesHigh sensitivity, site-specificSample preparation challenges
Phospho-specific antibodiesDetection of phosphorylated proteinIn vivo applicationsAntibody specificity concerns
32P labelingQuantification of phosphorylationDirect measurementRadiation hazards, time constraints

While these findings focused on the β subunit, similar regulatory mechanisms may exist for atpF that could influence proton translocation or interactions with other subunits .

What is the relationship between protein quality control networks and ATP synthase in Caulobacter?

Caulobacter species possess sophisticated protein quality control (PQC) networks that likely interact with ATP synthase components. These systems include:

  • ATP-dependent proteases: ClpP can associate with either ClpX or ClpA unfoldase subunits to form proteolytic complexes that target specific proteins for degradation

  • Disaggregases: ClpB functions as a disaggregase that specifically remediates aggregated proteins. While typically expressed only during stress, ClpB is essential for dissolving stress-induced protein aggregates and for the shutoff phase of the σ32-dependent stress response

  • Holdases: Small heat shock proteins (sHSPs) such as sHSP1 and sHSP2 act as holdases that assist with organizing unfolded proteins during stress conditions

Since ATP synthase is critical for energy production, it is likely subject to tight quality control. During stress conditions, the PQC network may prioritize maintaining ATP synthase integrity to ensure cellular energy production. Damaged or misfolded ATP synthase components, including atpF, would need to be recognized and either refolded or degraded by these systems.

How do mutations in atpF affect ATP synthase assembly and function?

The study of mutations in ATP synthase components provides valuable insights into structure-function relationships. Research on ATP synthase β subunit demonstrates that specific amino acid changes can have profound effects:

  • Mutations affecting phosphorylation sites can alter both enzyme activity and complex formation

  • Some mutations may specifically impact the stability of ATP synthase complexes without affecting initial assembly

  • Critical mutations can result in the accumulation of lower-molecular-weight forms of the protein, indicating assembly or stability defects

For atpF specifically, mutations might affect:

Experimental approaches to study such mutations include site-directed mutagenesis, complementation studies in knockout strains, and in vitro reconstitution of mutant proteins into functional complexes.

How does ATP synthase in Caulobacter compare to other bacterial species?

ATP synthase is highly conserved across bacterial species, yet exhibits important variations that reflect evolutionary adaptations:

FeatureCaulobacterE. coliThermophilic bacteria
F0 compositionContains b subunit (atpF)Contains b subunitMay have specialized heat-stable versions
Temperature optimumMesophilic rangeMesophilic rangeHigher temperature range
Regulatory mechanismsIncludes potential phosphorylationWell-characterized regulationOften has enhanced stability features
Cell cycle regulationMay be linked to asymmetric cell cycleNot linked to asymmetric divisionVaries by species

Caulobacter's distinctive asymmetric life cycle could influence how ATP synthase function is regulated during cell differentiation and division . The protein quality control systems in Caulobacter that interface with cell cycle progression may also uniquely interact with ATP synthase components compared to other bacterial models.

What are the primary challenges in studying recombinant ATP synthase components?

Researchers face several challenges when working with recombinant ATP synthase components like atpF:

  • Structural integrity: Ensuring proper folding of the recombinant protein, especially for membrane-associated components that may require specific lipid environments

  • Functional reconstitution: Assembling complete, functional complexes from individual recombinant components to study activity

  • Post-translational modifications: Identifying and characterizing physiologically relevant modifications that may affect function, as demonstrated by the significant effects of phosphorylation on ATP synthase β subunit

  • Experimental design complexity: Controlling for all relevant variables when studying enzyme activity in reconstituted systems

  • Protein stability: Maintaining protein stability during purification and storage, especially for membrane-associated components like atpF

Advanced approaches to address these challenges include sophisticated membrane protein reconstitution techniques, site-specific incorporation of phosphomimetic amino acids, and combining structural and functional analyses.

What emerging techniques show promise for ATP synthase research?

Several cutting-edge approaches are advancing ATP synthase research:

  • Cryo-electron microscopy: Providing high-resolution structural insights into ATP synthase complexes without crystallization

  • Single-molecule techniques: Allowing observation of rotational dynamics and energy coupling in individual ATP synthase complexes

  • Nanodiscs and advanced membrane mimetics: Improving reconstitution of membrane proteins like atpF in near-native environments

  • Optogenetic approaches: Enabling precise temporal control of ATP synthase activity or associated regulatory factors

  • Advanced phosphoproteomics: Identifying physiologically relevant phosphorylation sites with improved sensitivity and precision

These techniques can be particularly valuable for studying atpF function within the context of the complete ATP synthase complex and its interaction with the Caulobacter protein quality control network .

How might atpF research inform broader understanding of bacterial bioenergetics?

Research on Caulobacter ATP synthase subunit b contributes to our understanding of bacterial energy metabolism in several ways:

  • Providing insights into how ATP synthesis is regulated during different phases of asymmetric cell cycles

  • Revealing potential stress-responsive modifications that may affect energy production under unfavorable conditions

  • Elucidating how membrane protein complexes are maintained by protein quality control networks

  • Identifying potential antimicrobial targets, as disruption of ATP synthesis represents a promising therapeutic strategy

Future research directions should explore the integration of atpF function with cell cycle regulation, stress responses, and bacterial adaptation to changing environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.