Recombinant Caulobacter sp. Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant HtpX is produced via E. coli expression systems, followed by affinity chromatography using its His-tag. Key production metrics:

  • Purity: >90% (SDS-PAGE verified)

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage

  • Storage: -20°C/-80°C; avoid repeated freeze-thaw cycles

Biochemical Properties

While direct enzymatic assays for Caulobacter HtpX are not reported, inferences from homologs suggest:

  • Catalytic Mechanism: Zinc-dependent endoprotease activity, targeting misfolded membrane proteins .

  • Substrate Specificity: Preferential cleavage of membrane-localized proteins (e.g., SecY in E. coli) .

  • Thermostability: Likely stable under moderate thermal stress, as observed in haloarchaeal HtpX systems .

Functional Role in Bacterial Physiology

HtpX proteases are implicated in quality control of membrane proteins and stress adaptation:

  • Stress Response: Upregulated during proteotoxic stress to degrade misfolded proteins, collaborating with ATP-dependent proteases like FtsH .

  • Cell Cycle Regulation: In Caulobacter, protease networks (e.g., ClpXP) are critical for cell-cycle progression , though HtpX’s direct role remains uncharacterized.

  • Membrane Protein Homeostasis: Degrades damaged membrane proteins, preventing cytotoxicity .

Research Applications

Recombinant HtpX is utilized in:

  1. Enzymatic Studies: Investigating zinc metalloprotease mechanisms and substrate specificity.

  2. Structural Biology: Crystallization trials to resolve catalytic domains.

  3. Stress Response Models: Analyzing bacterial adaptation to environmental stressors.

  4. Biotechnological Tools: Optimizing protein expression systems by mitigating membrane protein aggregation .

Comparative Insights from Homologs

FeatureCaulobacter HtpXE. coli HtpX
LocalizationMembrane-associatedMembrane-integrated
Catalytic CofactorZn²⁺Zn²⁺
Stress InductionHypothesized (unconfirmed)Heat shock, membrane damage
Genetic InteractionsUnclearCooperates with FtsH protease

Future Directions

  • Functional Characterization: Direct assays to confirm Caulobacter HtpX’s role in membrane protein turnover.

  • Structural Analysis: Cryo-EM studies to map zinc-binding sites and substrate interaction regions.

  • Physiological Context: Elucidate synergies with ClpXP and other proteolytic systems in Caulobacter .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please clearly indicate your desired format in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing cycles should be avoided. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol includes a final glycerol concentration of 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is finalized during the production process. If you have a preferred tag type, please specify it, and we will prioritize its development.
Synonyms
htpX; Caul_3512; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Caulobacter sp. (strain K31)
Target Names
htpX
Target Protein Sequence
MNHLKTFILLAGLTALFVGAGYMIGGPTGMLVALVLAVGMNLFSYWNADKIVLRMYGAVE VDASHPEPRVRAYVADVEDLARRAGLPRPRITVIDSQQPNAFATGRDPDHAAVAASTGLL GLLDRDEIRGVMAHELAHVKNRDTLTMTVTATIAGAISALANFAFFFGGSRDDDERPGGL VGTIALAILAPIAAMLVQMAISRSREYEADRIGAQIAGDGLALARALEKIEAYARGGAVN VEAERNPATAHLFIINPLSGRGRDSLFSTHPATRNRVEALLRLGVSQATRGRSGTAVPTG ATGKSGPWG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does HtpX expression change during the Caulobacter cell cycle?

To determine HtpX expression patterns across the Caulobacter cell cycle, researchers should employ synchronized cell populations using established methods such as density gradient centrifugation or selective adhesion. Time-course sampling followed by quantitative RT-PCR and western blot analysis would reveal transcriptional and translational regulation patterns. Based on studies of other Caulobacter proteases, expression may fluctuate in coordination with developmental transitions, as observed with ClpXP substrates whose degradation is precisely timed during cell cycle progression . Cell-cycle dependent proteolysis in Caulobacter is often regulated through sophisticated adaptor hierarchies, which might also influence HtpX activity even if expression remains constant.

What experimental approaches can identify potential substrates of HtpX in Caulobacter?

To identify HtpX substrates, researchers should implement a multi-faceted approach:

  • Construct tagged, catalytically inactive HtpX variants (by mutating the zinc-binding motif) to trap substrates

  • Perform immunoprecipitation followed by mass spectrometry

  • Compare proteomes of wild-type and ΔhtpX strains under various stress conditions

  • Validate direct interactions through in vitro degradation assays

This methodology mirrors approaches used to identify ClpXP substrates in Caulobacter, where proteomic studies revealed numerous substrates involved in DNA replication and repair . Since HtpX likely targets membrane proteins, membrane fractionation prior to analysis is essential.

How does HtpX interact with other proteolytic systems in Caulobacter during stress responses?

The interaction between HtpX and other proteases likely forms a coordinated proteolytic network. To investigate these relationships, researchers should create strains with various combinations of protease deletions/depletions (e.g., ΔhtpX/ClpX-depletion). Comprehensive proteomic analysis comparing single and double mutants under various stress conditions would reveal compensatory relationships.

In Caulobacter, the ClpXP protease integrates multiple signals through the ClpX N-domain , allowing coordination of substrate degradation during normal growth and stress responses. Similarly, HtpX likely participates in an integrated stress response network. When one protease is compromised or saturated, others may compensate, as evidenced by the hierarchy of adaptors regulating ClpXP-mediated proteolysis . The response of ΔhtpX strains to specific stressors (oxidative, heat, envelope stress) compared to wild-type would help position HtpX within this proteolytic network.

What structural determinants in HtpX dictate substrate specificity in Caulobacter?

Understanding structural elements governing HtpX substrate selection requires:

  • Generation of chimeric constructs between Caulobacter HtpX and homologs from other bacteria

  • Site-directed mutagenesis of conserved and variable regions

  • In vitro degradation assays with potential substrates

  • Structural analysis using crystallography or cryo-EM

This approach parallels investigations of ClpX, where the N-terminal domain was found to play a crucial, species-specific role . As demonstrated in ClpX studies, domain-swapping experiments between Caulobacter and E. coli protease homologs revealed that although E. coli ClpX functions with Caulobacter ClpP in vitro, it cannot complement wildtype activity in vivo . Similar species-specificity may exist for HtpX, potentially influencing its substrate range and regulatory mechanisms.

How does post-translational modification regulate HtpX activity during cell cycle progression?

To investigate post-translational regulation of HtpX:

  • Perform phosphoproteomic and other PTM analyses of HtpX across the cell cycle

  • Create non-modifiable HtpX variants through site-directed mutagenesis

  • Assess activity of modified versus unmodified HtpX through in vitro degradation assays

  • Monitor cell cycle phenotypes in strains expressing non-modifiable HtpX variants

Studies of ClpXP in Caulobacter have shown that adaptor proteins like CpdR, RcdA, and PopA create a hierarchical regulatory system . While adaptor proteins specifically regulating HtpX haven't been identified, similar regulatory mechanisms may exist, potentially involving post-translational modifications of HtpX itself or its adaptors.

What purification strategy yields optimal activity for recombinant Caulobacter HtpX?

For optimal purification of active recombinant HtpX:

  • Express with a cleavable N-terminal tag (His6 or MBP) to avoid interference with the C-terminal substrate recognition regions

  • Include detergents (DDM or CHAPS) throughout purification to maintain membrane protein solubility

  • Incorporate zinc in buffers to ensure metalloprotease activity

  • Verify activity using fluorogenic peptide substrates

The purification approach should consider lessons from Caulobacter ClpXP studies, where specific buffer conditions and cofactors were crucial for maintaining activity . Since HtpX is membrane-associated, detergent selection is particularly critical.

How can researchers develop reliable activity assays for Caulobacter HtpX?

Development of robust HtpX activity assays should include:

  • Fluorogenic peptide substrates based on predicted cleavage sites

  • FRET-based assays for monitoring protein substrate degradation

  • Membrane protein degradation assays using reconstituted proteoliposomes

  • Cellular degradation assays using pulse-chase with identified substrates

Activity measurements should account for potential cofactor requirements and optimal reaction conditions, similar to the careful biochemical characterization performed with ClpXP . Based on protease studies in Caulobacter, assay conditions should examine various pH values, salt concentrations, and divalent cation requirements for optimal activity.

What genetic approaches best elucidate HtpX function in Caulobacter?

To genetically characterize HtpX function:

ApproachMethodologyExpected OutcomesLimitations
Gene deletionCRISPR-Cas9 or homologous recombinationPhenotypic consequences of complete lossMay be lethal or show minimal phenotype due to redundancy
Conditional depletionXylose-inducible systemTemporal analysis of HtpX requirementLeaky expression; incomplete depletion
Domain mutagenesisSite-directed mutagenesis of catalytic and binding domainsStructure-function relationshipsMay disrupt protein folding
Suppressor screensTransposon mutagenesis in ΔhtpX backgroundIdentification of genetic interactionsLabor-intensive; may identify indirect interactions

This approach mirrors genetic studies of ClpXP in Caulobacter, where sophisticated depletion systems revealed that ClpXP essentiality stems from its role in degrading the SocB toxin , and where chimeric studies demonstrated the importance of the N-terminal domain for species-specific functions .

How can researchers distinguish direct HtpX substrates from indirect proteomic changes?

To differentiate direct from indirect effects in proteomic analyses:

  • Compare wild-type, catalytically inactive HtpX, and ΔhtpX strains

  • Perform time-resolved degradation assays with purified components

  • Utilize tandem mass tag (TMT) labeling for quantitative proteomics

  • Apply statistical filters (fold-change thresholds, p-value cutoffs)

Analysis should adopt approaches similar to those used in Caulobacter DNA damage response studies, where proteome-wide surveys distinguished transcriptional from post-translational regulation . Researchers should be aware that protease networks often have compensatory mechanisms, so changes in one pathway may mask direct effects.

What computational approaches best predict potential HtpX recognition motifs?

For computational prediction of HtpX substrates:

  • Analyze known substrates for sequence/structural patterns

  • Employ machine learning algorithms trained on similar metalloproteases

  • Apply structural modeling to predict membrane protein-HtpX interactions

  • Validate predictions with site-directed mutagenesis

This computational approach should incorporate lessons from studies of ClpXP, where degradation tags like the C-terminal di-aspartate in TacA were identified as crucial motifs for protease recognition . Membrane topology is particularly important for HtpX substrates, as the protease likely accesses only specific regions of membrane proteins.

How should researchers interpret phenotypic differences between Caulobacter HtpX and homologs in other bacteria?

When comparing HtpX function across bacterial species:

  • Consider evolutionary context and selective pressures

  • Analyze cellular pathways and protein interactions unique to each species

  • Account for differences in growth conditions and stress responses

  • Examine compensation by other proteases

The species-specific nature of protease function is evident in ClpX studies, where E. coli ClpX failed to complement Caulobacter ClpX deletion despite functioning with Caulobacter ClpP in vitro . This demonstrates that proteases evolve highly specific functions despite broad conservation. For HtpX, similar species-specific adaptations likely exist, potentially related to Caulobacter's distinctive cell cycle and developmental program.

What emerging technologies will advance understanding of HtpX function in Caulobacter?

Future research on Caulobacter HtpX will benefit from:

  • Cryo-electron tomography to visualize HtpX in native membrane environments

  • Proximity labeling approaches (BioID, APEX) to map the HtpX interactome

  • Single-cell proteomics to capture cell-cycle dependent dynamics

  • Systems biology approaches to model HtpX within the broader proteostasis network

As demonstrated by the hierarchical adaptor studies with ClpXP , understanding protease regulation often requires integrating multiple experimental approaches. For HtpX, combining structural, biochemical, and systems-level analyses will be particularly important for deciphering its role in membrane protein quality control within the unique context of Caulobacter's life cycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.