Recombinant Caulobacter sp. Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Caulobacter sp. CrcB homolog is a full-length protein (1–128 amino acids) expressed in E. coli with an N-terminal polyhistidine (His) tag for purification . Key structural and biochemical properties include:

PropertyDetails
UniProt IDB0T2G5
Amino Acid SequenceMTKLLLVAAGGALGSVARYLVGVQALRLFGSNWPYGTFIVNLTGGLLMGLLAAWLALRGGAQQEHWRVLLGVGVMGGFTTFSAFSLETALMIEKRAYAQAFTYTTASVILSVAAIFAGLLIARRIFSV
Molecular Weight~14.5 kDa (calculated)
Protein Length128 residues
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)

Expression and Purification

The protein is produced in E. coli and purified under standardized conditions:

  • Expression System: E. coli

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

  • Reconstitution: Solubilized in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage at -20°C/-80°C

  • Storage: Aliquots recommended to avoid freeze-thaw cycles

Functional Insights

CrcB is annotated as a putative fluoride ion transporter, though direct functional studies in Caulobacter remain limited. Homologs in other bacteria (e.g., E. coli) suggest roles in fluoride resistance, but Caulobacter CrcB’s specific mechanisms require further investigation . Notably, Caulobacter employs redundant outer membrane transporters like RsaF a/b for S-layer protein export , but CrcB’s involvement in similar pathways is unconfirmed.

Research Applications

  • Structural Studies: Full-length sequence enables crystallography or NMR to resolve tertiary structure.

  • Transport Mechanism Analysis: Comparative studies with homologs (e.g., E. coli CrcB) to elucidate ion translocation .

  • Antibiotic Resistance Research: Potential links to fluoride efflux in bacterial stress responses .

Comparative Analysis of CrcB Homologs

CrcB homologs across species share structural motifs but diverge in sequence and function:

SpeciesUniProt IDLength (aa)Key Features
Caulobacter sp. K31B0T2G5128N-terminal His tag; putative fluoride transporter
E. coli O17:K52:H18B7N9N012739% identity with Caulobacter homolog; implicated in fluoride efflux
Synechocystis sp.P72836130Glycine-rich regions; similar putative transport function
Silicibacter sp. TM1040Q1GJZ3126Expressed in E. coli; structural homology to Caulobacter CrcB

Challenges and Future Directions

  • Functional Validation: Direct assays (e.g., fluoride uptake/efflux) are needed to confirm transport activity.

  • Regulatory Mechanisms: Transcriptional control of crcB in Caulobacter remains unexplored.

  • Interactome Mapping: Identifying binding partners could clarify its role in cellular homeostasis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; Caul_1657; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Caulobacter sp. (strain K31)
Target Names
crcB
Target Protein Sequence
MTKLLLVAAGGALGSVARYLVGVQALRLFGSNWPYGTFIVNLTGGLLMGLLAAWLALRGG AQQEHWRVLLGVGVMGGFTTFSAFSLETALMIEKRAYAQAFTYTTASVILSVAAIFAGLL IARRIFSV
Uniprot No.

Target Background

Function
Crucial for reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is crcB related to fluoride riboswitches?

The crcB gene is associated with a fluoride-responsive riboswitch RNA motif (RF01734). This cis-regulatory element controls gene expression in response to fluoride ion concentrations. The fluoride riboswitch regulates the expression of genes involved in fluoride toxicity resistance, including crcB and other fluoride exporters. The riboswitch acts as a genetic "on switch" that increases expression of these genes when fluoride levels rise to potentially toxic concentrations .

What experimental conditions are optimal for working with recombinant crcB protein?

For optimal handling of recombinant crcB protein:

  • Storage temperature: -20°C for regular storage; -20°C to -80°C for extended storage

  • Buffer composition: Tris-based buffer with 50% glycerol (optimized specifically for crcB)

  • Working conditions: Store aliquots at 4°C for up to one week

  • Stability considerations: Avoid repeated freeze-thaw cycles as they may compromise protein integrity

These conditions help maintain protein stability and functionality for experimental applications .

What genetic mapping approaches can be used to study crcB function in Caulobacter species?

Researchers can employ a systematic genetic mapping approach using bacteriophage-mediated transduction to study crcB function:

  • Identify genomic locations near the crcB gene for strategic placement of antibiotic resistance markers

  • Clone DNA fragments from these sites into a kanamycin-resistant suicide vector

  • Deliver the plasmids into Caulobacter, allowing integration via homologous recombination

  • Use the resulting strains as donors for generalized transduction using bacteriophage φCr30

  • Select transductants with kanamycin and screen for phenotypes related to crcB function

This methodology allows precise localization of mutations to DNA sequence intervals equivalent to less than 1% of the genome, enabling detailed genetic analysis of crcB function and interactions .

How can protein quality control experiments be designed to study crcB's role during cellular stress?

To investigate crcB's potential role in protein quality control:

  • Expose Caulobacter cultures to fluoride stress at various concentrations and monitor crcB expression levels

  • Compare protein aggregate formation in wild-type and crcB-deficient strains during fluoride stress

  • Examine potential interactions between crcB and major stress response proteins (ClpXP, DnaK/J, GroESL)

  • Analyze cell cycle progression in relation to crcB expression during stress conditions

  • Study the localization of crcB protein during normal growth versus stress conditions

This approach builds on established protocols for studying protein quality control networks in Caulobacter, which have shown that these networks interface with cell cycle regulation and stress response mechanisms .

What expression systems are recommended for producing recombinant crcB protein?

While specific expression systems for crcB are not detailed in the search results, researchers should consider the following based on general practices for membrane proteins:

  • Expression host selection: E. coli BL21(DE3) or specialized strains for membrane proteins

  • Vector design: Include appropriate fusion tags (His, GST, or MBP) to aid purification

  • Induction parameters: Lower temperatures (16-20°C) and reduced inducer concentrations to prevent inclusion body formation

  • Membrane extraction: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) for solubilization

  • Purification strategy: Implement a two-step approach combining affinity chromatography and size exclusion

These recommendations align with standard practices for producing recombinant membrane proteins while maintaining their native structure and function.

How might crcB function integrate with Caulobacter's cell cycle regulation?

Caulobacter's distinctive asymmetric cell cycle involves sophisticated protein regulatory networks. To investigate crcB's potential role:

  • Compare crcB expression levels between swarmer and stalked cells using synchronized cultures

  • Analyze whether crcB is subject to cell cycle-dependent degradation by ClpXP, similar to other cell cycle regulators like CtrA

  • Investigate if crcB function is influenced by phosphosignaling networks that control developmental transitions

  • Determine whether fluoride stress (which may involve crcB) affects chromosome replication timing or DnaA activity

This research direction would build on existing knowledge of Caulobacter's cell cycle regulation, where factors like CtrA and DnaA compete to control chromosome replication .

What methodological approaches can address contradictions in crcB localization data?

When faced with contradictory findings regarding crcB subcellular localization:

  • Implement complementary localization techniques:

    • Fluorescent protein fusions (GFP, mCherry) for live-cell imaging

    • Immunogold electron microscopy for high-resolution fixed-cell analysis

    • Biochemical fractionation followed by Western blotting

  • Validate localization under diverse conditions:

    • Different growth phases

    • Various stress conditions (fluoride, heat, osmotic)

    • Cell cycle stages

  • Perform functionality assays to ensure tagged proteins retain native function

  • Use super-resolution microscopy (PALM/STORM) to resolve fine localization patterns

How can researchers investigate crcB's role in Caulobacter's environmental adaptation mechanisms?

To study crcB's contribution to environmental adaptation:

  • Create deletion and overexpression strains to assess phenotypes under various stress conditions

  • Analyze transcriptional responses using RNA-seq to identify genes co-regulated with crcB during stress

  • Perform comparative genomics across Caulobacter species from different ecological niches to analyze crcB conservation

  • Conduct evolution experiments under fluctuating fluoride concentrations to identify adaptive mutations

  • Measure fluoride tolerance in relation to crcB expression levels across growth conditions

This research would connect to broader studies of Caulobacter's specialized physiology, which influences how it copes with various environmental stresses .

What statistical approaches are recommended for analyzing crcB fluoride response data?

For robust analysis of crcB-related fluoride response experiments:

  • Implement appropriate experimental designs:

    • Include biological replicates (n≥3) and technical replicates

    • Incorporate proper controls (wild-type, vehicle, positive controls)

    • Use dose-response approaches with multiple fluoride concentrations

  • Apply statistical methods:

    • Two-way ANOVA for analyzing multiple variables (e.g., fluoride concentration and time)

    • Survival curve analysis for tolerance experiments

    • Multiple comparison corrections (Bonferroni, FDR) for genome-wide studies

  • Visualization recommendations:

    • Log-scale representations for dose-response relationships

    • Heat maps for multi-condition experiments

    • Time-course trajectory plots for dynamic responses

How should researchers interpret evolutionary conservation patterns of crcB across bacterial species?

When analyzing crcB evolutionary conservation:

  • Distinguish between sequence conservation and functional conservation

  • Consider genomic context - is crcB consistently associated with fluoride riboswitches across species?

  • Analyze selection pressure signatures in the coding sequence using dN/dS ratios

  • Examine structural conservation of protein domains versus variable regions

  • Integrate environmental data about natural fluoride levels in habitats of different species

Careful interpretation of conservation patterns can reveal evolutionary pressures and functional significance of crcB across bacterial lineages.

What are promising approaches for studying crcB interactions with the bacterial membrane?

To investigate crcB-membrane interactions:

  • Membrane protein topology mapping using:

    • Cysteine accessibility methods

    • Protease protection assays

    • GFP-fusion analysis at different insertion points

  • Lipid interaction studies:

    • Reconstitution in liposomes of varying composition

    • Fluorescence resonance energy transfer (FRET) with labeled lipids

    • Molecular dynamics simulations of protein-lipid interactions

  • Functional reconstitution:

    • Development of fluoride transport assays in proteoliposomes

    • Patch-clamp electrophysiology if channel activity is suspected

    • Measurement of membrane integrity during fluoride stress

These methodologies would provide insight into how crcB functions within the membrane environment to potentially mediate fluoride resistance.

How can systems biology approaches advance understanding of crcB in cellular networks?

Systems biology offers powerful tools for contextualizing crcB function:

  • Network analysis methods:

    • Construct protein-protein interaction networks through IP-MS or bacterial two-hybrid screens

    • Develop gene regulatory networks incorporating the fluoride riboswitch

    • Map metabolic impacts of fluoride stress and crcB activity

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Link crcB expression to global cellular responses

    • Identify condition-specific regulatory patterns

  • Mathematical modeling:

    • Develop kinetic models of fluoride transport

    • Simulate riboswitch dynamics in response to changing fluoride levels

    • Model cellular adaptation to fluoride stress

These approaches would position crcB within the broader context of Caulobacter's complex regulatory networks that manage cell differentiation and stress responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.