Recombinant Caulobacter sp. Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Caulobacter sp. Undecaprenyl-diphosphatase (uppP)

Recombinant Caulobacter sp. undecaprenyl-diphosphatase (uppP) is a membrane-associated enzyme critical for bacterial cell wall synthesis and stress response. This protein catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a lipid carrier essential for translocating peptidoglycan and other glycopolymers across bacterial membranes .

Protein Architecture

The enzyme exists as a transmembrane protein with a predicted α-helical structure. Key structural motifs include:

  • Active site residues:

    • (E/Q)XXXE motif: Involved in phosphate binding and catalysis .

    • PGXSRSXXT motif: Contributes to substrate recognition and enzymatic activity .

    • His-30 and Arg-174: Critical for stabilizing the pyrophosphate moiety of UPP during catalysis .

Catalytic Mechanism

UppP dephosphorylates UPP to UP, recycling the lipid carrier for repeated synthesis of peptidoglycan and other cell wall components . In Bacillus subtilis, uppP and BcrC form a synthetic lethal pair, ensuring UP homeostasis under stress .

Recombinant Production and Purification

Recombinant uppP is produced via heterologous expression systems, primarily in E. coli. Key production parameters include:

ParameterDetails
Expression SystemE. coli (in vitro) or mammalian cells (partial/full-length) .
TaggingN-terminal 10xHis-tag for purification .
Purity>85% (SDS-PAGE) .
Storage-20°C/-80°C (liquid); 12 months (lyophilized) .
ActivityConfirmed via enzymatic assays targeting UPP dephosphorylation .

Role in Cell Wall Synthesis and Stress Response

  • Peptidoglycan recycling: UppP ensures UP availability for lipid II cycle turnover, critical for peptidoglycan assembly .

  • Sporulation in B. subtilis: UppP is indispensable for spore formation, as its deletion leads to defective cortex synthesis and reduced heat resistance .

  • Cell envelope stress response (CESR): UppP depletion triggers σ<sup>M</sup>-dependent stress signaling, upregulating bcrC expression to compensate for UP shortages .

Bacitracin Resistance

UppP competes with bacitracin for UPP binding, acting as a secondary resistance determinant. Deletion of uppP reduces bacitracin MIC in B. subtilis, highlighting its role in antibiotic resistance .

Critical Residues and Mutagenesis Studies

Mutagenesis has identified key residues for enzymatic activity:

ResidueFunctionActivity Impact
His-30Stabilizes pyrophosphate via hydrogen bondsH30A: Severe activity loss .
Arg-174Binds pyrophosphate OH groupR174A: Complete inactivity .
Glu-34Phosphate coordination in (E/Q)XXXE motifE34A: Reduced catalysis .

Applications in Antimicrobial Research

UppP is a target for disrupting bacterial cell wall synthesis. Inhibitors of UPP phosphatases, such as bacitracin, exploit the enzyme’s essential role in UP recycling, offering therapeutic potential .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. This can serve as a reference for your own protocols.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its inclusion in the development process.
Synonyms
uppP; Caul_4952; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Caulobacter sp. (strain K31)
Target Names
uppP
Target Protein Sequence
MPDWLIAIVLGLVEGLTEFIPVSSTGHLLLTKIALGLTDPAWDTFIVLIQLGAVLGVVAL YFQRLWAVVVGLPTQPEARRFALTVLIGCIPAFAAGLALHGVIKHFFENPYLPQVICVSL ILGGVILLVVDKKAPPPREMDGMALSLKTAALIGLFQCLSLLPGVSRSGSTIVGSMLIGV DRKAAAEFSFFMAIPIMVGAFALDLLKSYKDIDASHAGAIAIGFVVSFLSGLVVVKFLID FVGKRGFTPFAWWRIVVGVIGLGLIYIPR
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its primary function in Caulobacter sp.?

Undecaprenyl-diphosphatase (uppP), also known as bacitracin resistance protein or undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an integral membrane enzyme that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (C55-PP) to undecaprenyl phosphate (C55-P). In Caulobacter species, such as strain K31, uppP is encoded by the uppP gene (CauL_4952) . The primary function of uppP is to generate C55-P, which serves as the essential lipid carrier for building blocks of peptidoglycan and other cell wall components .

The Caulobacter sp. uppP protein consists of 269 amino acids and is predicted to contain multiple transmembrane segments, consistent with its role as an integral membrane protein . Sequence analysis suggests it has eight transmembrane domains, similar to the characterized E. coli homolog . The enzyme's active site is positioned to access the pyrophosphate group of the substrate C55-PP, facilitating the removal of the terminal phosphate group to generate C55-P, which is essential for cell wall biosynthesis .

How does uppP contribute to bacterial cell wall synthesis?

Undecaprenyl-diphosphatase (uppP) plays a crucial role in the lipid carrier cycle required for bacterial cell wall synthesis. This cycle operates through several distinct steps in which uppP performs a critical function. First, undecaprenyl pyrophosphate (C55-PP) is synthesized by undecaprenyl pyrophosphate synthase (UppS) through the addition of eight C5 isopentenyl units onto C15 farnesyl pyrophosphate . UppP then dephosphorylates C55-PP to form C55-P (undecaprenyl phosphate), which serves as the essential lipid carrier in peptidoglycan synthesis .

Once formed, C55-P accepts activated sugar-peptide precursors to form lipid intermediates that are translocated across the cytoplasmic membrane to provide building blocks for peptidoglycan synthesis on the periplasmic side . After the sugar-peptide building blocks are transferred to the growing peptidoglycan chain, C55-PP is released and must be recycled back to C55-P by uppP to continue the cycle . This recycling process is critical because the cellular pool of these lipid carriers is limited, and efficient recycling is necessary to maintain cell wall synthesis .

In Caulobacter species, this pathway not only supports peptidoglycan synthesis but also contributes to holdfast formation, which allows the bacteria to adhere permanently to surfaces and form biofilms . The holdfast polysaccharide synthesis is initiated when a glycosyltransferase (HfsE) transfers activated sugar phosphate from UDP-GlcNAc to undecaprenyl-phosphate (Und-P) lipid carrier , directly linking uppP activity to adhesion capabilities.

What is the relationship between uppP and bacitracin resistance?

Undecaprenyl-diphosphatase (uppP) plays a significant role in bacterial resistance to bacitracin, which explains its alternative designation as "bacitracin resistance protein" . This relationship stems from the specific mechanism of action of bacitracin as an antibiotic. Bacitracin binds specifically to undecaprenyl pyrophosphate (C55-PP), preventing its dephosphorylation to undecaprenyl phosphate (C55-P) . By inhibiting this dephosphorylation step, bacitracin blocks the recycling of the lipid carrier, ultimately disrupting cell wall synthesis and leading to bacterial cell death .

The protective role of uppP against bacitracin was demonstrated when overexpression of the E. coli bacA gene (later renamed uppP) was shown to confer resistance to high concentrations of bacitracin . This overproduction was correlated with a 280-fold increase in C55-PP phosphatase activity in membranes . The increased level of uppP activity accelerates the conversion of the bacitracin target (C55-PP) to C55-P, effectively reducing the pool of C55-PP that can be targeted by the antibiotic .

This mechanism highlights the importance of uppP not just in normal cell wall synthesis but also as a determinant of antibiotic susceptibility. The fact that overexpression of uppP confers bacitracin resistance suggests that the enzyme represents a potential target for adjuvant therapies that could enhance the efficacy of bacitracin or similar antibiotics by inhibiting the phosphatase activity .

What is the role of undecaprenyl phosphate in holdfast formation in Caulobacterales?

Undecaprenyl phosphate (Und-P or C55-P) plays a critical role in holdfast formation in Caulobacterales species. The holdfast is a polar adhesin structure that allows these bacteria to adhere permanently to surfaces and form biofilms . This adhesive structure is essential for the characteristic lifestyle of Caulobacter and related species, which attach to surfaces in aquatic environments.

The biosynthesis of holdfast polysaccharide begins in the cytoplasm with the glycosyltransferase HfsE, which transfers activated sugar phosphate from UDP-GlcNAc to undecaprenyl-phosphate (Und-P) lipid carrier . This initial step anchors the nascent oligosaccharide to the membrane via the lipid carrier. Additional sugar residues are then added to form a repeat unit on the lipid carrier by three glycosyltransferases: HfsG, HfsJ, and HfsL . These repeat units undergo modifications by the acetyltransferase HfsK and the polysaccharide deacetylase HfsH .

The lipid carrier with the attached repeat units is then transported across the inner membrane into the periplasm by a flippase (HfsF) . In the periplasm, the repeat units are polymerized by two polysaccharide polymerases, HfsC and HfsI, to form the holdfast polysaccharide . This undecaprenyl phosphate-dependent pathway directly links cell wall precursor synthesis with holdfast production, connecting the activities of enzymes like uppP to the adhesion capabilities and biofilm formation of Caulobacter species.

What experimental approaches can be used to measure the enzymatic activity of recombinant Caulobacter sp. uppP?

Measuring the enzymatic activity of recombinant Caulobacter sp. undecaprenyl-diphosphatase (uppP) requires specialized techniques suitable for membrane proteins. Several experimental approaches can be employed:

  • Phosphate release assays: The most direct method involves measuring the release of inorganic phosphate when uppP dephosphorylates C55-PP. This can be quantified using colorimetric methods such as the malachite green assay, which detects free phosphate released during the reaction . The E. coli uppP enzyme has been shown to exhibit high C55-PP phosphatase activity of approximately 2200 nmol min⁻¹ mg⁻¹ of protein , providing a benchmark for comparing the Caulobacter enzyme.

  • Detergent-based micelle systems: Since uppP is an integral membrane protein, it requires proper solubilization in detergent micelles to maintain activity in vitro. The n-dodecyl-β-D-maltoside detergent has been successfully used to extract and purify active uppP from E. coli membranes and may be suitable for the Caulobacter homolog as well.

  • Bacitracin antagonism assay: An indirect method to assess uppP activity involves measuring the ability of the expressed enzyme to confer bacitracin resistance. This can be done by determining the minimum inhibitory concentration (MIC) of bacitracin in cells expressing different levels of uppP . Increased resistance correlates with higher enzymatic activity.

  • HPLC or TLC analysis: High-performance liquid chromatography or thin-layer chromatography can be used to directly monitor the conversion of C55-PP to C55-P. This approach provides direct evidence of substrate consumption and product formation.

A typical experimental protocol would include purification of the recombinant protein using affinity chromatography, reconstitution in an appropriate detergent system, and optimization of reaction conditions (pH, temperature, divalent cation requirements) . Activity would be measured by quantifying either phosphate release or direct product formation under initial velocity conditions at varying substrate concentrations.

How can mutations in uppP affect biofilm formation in Caulobacter species?

Mutations in the undecaprenyl-diphosphatase (uppP) gene can significantly impact biofilm formation in Caulobacter species through several interconnected mechanisms centered around holdfast biosynthesis and cell wall integrity.

Primarily, uppP mutations can disrupt holdfast synthesis by limiting the availability of undecaprenyl phosphate (C55-P), which serves as the lipid carrier for holdfast polysaccharide precursors . The holdfast is essential for the initial attachment of Caulobacter cells to surfaces, which represents the first critical step in biofilm formation . If mutations reduce uppP activity, the decreased pool of C55-P would limit holdfast production, resulting in reduced surface attachment capabilities.

Additionally, alterations in uppP function can have broader effects on cell wall synthesis since C55-P is required for peptidoglycan assembly . Compromised cell wall integrity may affect cell morphology and the ability to form structured biofilms. The complex architecture of biofilms depends on proper cell shape and surface properties, both of which can be altered by defects in cell wall synthesis.

From a regulatory perspective, defects in C55-P recycling due to uppP mutations may trigger envelope stress responses, which can alter the expression of genes involved in biofilm formation. Such stress-induced changes may affect the transition from planktonic to biofilm lifestyle and the subsequent maturation of the biofilm structure.

Interestingly, mutations in sugar-nucleotide synthesis genes have been found to restore holdfast production in certain contexts , suggesting that compensatory pathways may exist that can bypass or supplement deficiencies in the primary C55-P generation pathway. Studying these suppressor mutations could provide valuable insights into alternative mechanisms for maintaining holdfast synthesis and biofilm formation when the canonical pathway is compromised.

What structural characteristics of Caulobacter sp. uppP make it different from other bacterial undecaprenyl-diphosphatases?

The structural characteristics of Caulobacter sp. undecaprenyl-diphosphatase (uppP) reveal both conserved features shared with other bacterial homologs and potential unique aspects that may reflect its specific role in Caulobacter biology.

At the primary structure level, the Caulobacter sp. (strain K31) uppP protein consists of 269 amino acids , which is comparable to the 273 amino acids of the E. coli homolog. The Caulobacter protein sequence (MPDWLIAIVLGLVEGLTEFIPVSSTGHLLLTKIALGLTDPAWDTFIVLIQLGAVLGVVALYFQRLWAVVVGLPTQPEARRFALTVLIGCIPAFAAGLALHGVIKHFFENPYLPQVICVSLIILGGVILLVVDKKAPPPREMFGMALSLKTAALIGLFSCLSLLPGVSRSGSTIVGSMLIGVDRKAAAEFSFFMAIPIMVGAFALDLLKSYKDIDASHAGAIAIGFVVSFLSGLVVVKFLIDFVGKRGFTPFAWWRIVVGVIGLGLIYIPR) contains the characteristic features of the PAP2 (type 2 phosphatidic acid phosphatase) domain found in this enzyme family .

Hydropathy analysis suggests the presence of 8 transmembrane segments in Caulobacter uppP, similar to the E. coli BacA/UppP structure . This conserved membrane topology likely reflects the fundamental mechanism by which these enzymes access their lipid substrate within the membrane environment.

Additionally, Caulobacter species inhabit diverse aquatic environments that may subject them to different selective pressures compared to enteric bacteria. This ecological difference could be reflected in subtle structural adaptations that optimize enzyme function under the specific conditions encountered by Caulobacter in its natural habitats.

What experimental design considerations are important when studying the effects of temperature on Caulobacter sp. uppP activity?

When designing experiments to study the effects of temperature on Caulobacter sp. undecaprenyl-diphosphatase (uppP) activity, researchers must carefully consider several key factors to ensure valid and reproducible results.

First, it's essential to define clear variables in the experimental design . The independent variable would be temperature (typically ranging from 10-45°C to cover the physiological range of aquatic environments where Caulobacter species are found), while the dependent variable would be uppP enzymatic activity (measured as phosphate release rate or C55-P formation) . Potential confounding variables that should be controlled include pH (which can be temperature-dependent), buffer composition, substrate concentration, and enzyme concentration .

The experimental design should include both positive and negative controls . A well-characterized phosphatase with known temperature dependence could serve as a positive control, while reaction mixtures lacking enzyme or substrate would serve as negative controls. Additionally, time course measurements at each temperature point are crucial to ensure that initial velocity conditions are maintained and that the enzyme remains stable throughout the assay period.

The experimental design should also consider the natural habitat of Caulobacter species. For example, Caulobacter crescentus is commonly found in freshwater environments, while other species may inhabit marine or brackish waters with different ionic strengths . Therefore, testing temperature effects under varying ionic strength conditions would provide ecologically relevant insights into how environmental conditions affect enzyme function.

Statistical design must include sufficient biological and technical replicates (minimum three of each) to account for variability and enable robust statistical analysis . Data should be analyzed using appropriate statistical methods, such as Arrhenius plots to determine activation energy or non-linear regression to identify optimal temperature and thermal stability parameters.

How can researchers optimize expression systems for producing functional recombinant Caulobacter sp. uppP?

Optimizing expression systems for producing functional recombinant Caulobacter sp. undecaprenyl-diphosphatase (uppP) requires careful consideration of multiple factors to address the challenges associated with membrane protein expression.

The choice of expression host is crucial. While E. coli remains the most common host for heterologous protein expression, standard strains may not be ideal for membrane proteins like uppP. Specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), often provide better results by accommodating the potential toxicity associated with membrane protein overexpression. Alternatively, using Caulobacter itself as an expression host might preserve the native membrane environment and processing machinery.

Vector design considerations are equally important. For uppP expression, incorporating a C-terminal His-tag allows for purification while minimizing interference with membrane insertion, as the protein's N-terminus may be critical for proper topology. The use of a tightly controlled promoter system is advisable, as demonstrated in Hyphomonas neptunium (a marine Caulobacterale related to Caulobacter), where a copper-inducible promoter system (PCu) derived from the copAB operon has been successfully employed . This system allows expression to be fine-tuned using copper sulfate concentrations up to 500 μM without significant effects on growth .

Induction conditions significantly impact the yield of functional membrane proteins. Lower temperatures (16-20°C) during induction slow protein synthesis and allow proper membrane insertion and folding. Additionally, reduced inducer concentrations and extended induction times (16-24 hours) often improve the yield of correctly folded membrane proteins.

For purification of functional uppP, the choice of detergent is critical. The n-dodecyl-β-D-maltoside detergent has been successfully used to extract and purify active uppP from E. coli membranes and may be suitable for the Caulobacter homolog as well. Including stabilizing additives such as glycerol (10-20%) in purification buffers can help maintain protein stability and activity.

Finally, quality control is essential. Researchers should verify both protein purity by SDS-PAGE and functional activity through phosphatase assays to ensure that the optimized expression system yields not just protein, but properly folded, active enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.