Recombinant Causus rhombeatus NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please indicate any desired format preferences in your order notes, and we will do our best to fulfill your request.
Lead Time
Delivery timelines may vary depending on the purchase method and location. For specific delivery estimations, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please communicate your needs in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by a number of factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Causus rhombeatus (Rhombic night adder)
Target Names
Target Protein Sequence
PIAGSMVLAAILLKLGGYGMIRIIQILPSSKTDMFIPFITLSLWGAVLANLTCLQQTDLK SLIAYSSISHMGLVVAAISIQTQWSLSGAMALMIAHGFTSSALFCLANTSYERTHTRILI LTRGFHNILPMTTTWWLLSNLMNIATPPMMNFTSEFLILSSLFNWCPTTIILLSLSILIT SIYSLHIFLSTQMGPTLLNTQTEPAHSREHLLMTLHIIPLILLSMKPELVM
Uniprot No.

Target Background

Function
As a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), this protein is believed to be a crucial component of the minimal assembly necessary for catalytic activity. Complex I facilitates the transfer of electrons from NADH to the respiratory chain, with ubiquinone thought to be the enzyme's immediate electron acceptor.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4 and what is its role in mitochondrial function?

MT-ND4 (NADH-ubiquinone oxidoreductase chain 4) is a protein subunit of Complex I in the mitochondrial respiratory chain. It plays a crucial role in electron transport from NADH to ubiquinone, essential for oxidative phosphorylation and cellular energy production. In Causus rhombeatus, as in other organisms, MT-ND4 is encoded by the mitochondrial genome (mtDNA) .

The protein functions specifically in:

  • Facilitating electron transfer within Complex I

  • Contributing to the proton-pumping mechanism across the inner mitochondrial membrane

  • Maintaining the structural integrity of Complex I

Similar to related NADH dehydrogenase components like NDUFC1, MT-ND4 is responsible for the transportation of electrons from NADH to the respiratory chain essential for oxidative phosphorylation .

What are the characteristics of commercially available recombinant Causus rhombeatus MT-ND4?

The recombinant MT-ND4 protein from Causus rhombeatus is available as a partial-length protein with the following specifications:

PropertySpecificationSource
Product TypeRecombinant Protein
SpeciesCausus rhombeatus (Rhombic night adder)
Uniprot NumberO03707
Expression SourceMammalian cell or E. coli (depending on product)
Purity>85% (SDS-PAGE)
Protein LengthPartial
Gene NamesMT-ND4 (Synonyms: MTND4, NADH4, ND4)
Expression Region1-231

The recombinant protein maintains the functional domains necessary for research applications while offering consistent purity and characterization .

What are the optimal storage conditions for recombinant MT-ND4?

Proper storage of recombinant MT-ND4 is critical for maintaining protein integrity and experimental reproducibility. The following storage guidelines should be followed:

  • For short-term storage (up to one week): Store working aliquots at 4°C

  • For long-term storage: Store at -20°C/-80°C

  • Shelf life:

    • Liquid form: 6 months at -20°C/-80°C

    • Lyophilized form: 12 months at -20°C/-80°C

Important notes:

  • Repeated freezing and thawing cycles should be avoided as they can lead to protein degradation and loss of activity

  • The shelf life depends on multiple factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself

  • For maintenance of optimal protein function, it is advisable to prepare small working aliquots to minimize freeze-thaw cycles

What is the recommended reconstitution protocol for recombinant MT-ND4?

For optimal reconstitution of recombinant MT-ND4, follow this methodological approach:

  • Centrifuge the vial briefly prior to opening to bring contents to the bottom of the tube

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the default recommendation)

  • Prepare multiple small aliquots for long-term storage at -20°C/-80°C

This protocol helps maintain protein stability and activity while minimizing degradation. The addition of glycerol serves as a cryoprotectant to prevent protein denaturation during freeze-thaw cycles .

How can MT-ND4 be utilized in evolutionary studies and phylogenetic analyses of snakes?

MT-ND4 serves as a valuable molecular marker for evolutionary and phylogenetic studies of snakes, particularly within the Viperidae family, for several methodological reasons:

  • Phylogenetic utility: MT-ND4 has been established as an informative genetic marker for resolving relationships among snake taxa, particularly in caenophidian snakes

  • Methodological application: In snake phylogenetic studies, MT-ND4 can be used alongside other mitochondrial genes (e.g., cytb) and nuclear markers to construct multi-gene phylogenies with stronger resolving power

  • Protocol for phylogenetic analysis:

    • DNA extraction from snake tissue samples

    • PCR amplification of MT-ND4 using snake-specific primers

    • Sequencing of amplified products

    • Alignment with homologous sequences from other taxa

    • Phylogenetic tree construction using maximum likelihood or Bayesian methods

    • Assessment of node support using bootstrap or posterior probability values

  • Statistical evaluation: Support values for phylogenetic clades can be categorized as:

    • Unquestionable (>95% for both methods)

    • Strong (>80% for both methods)

    • Moderate (>70% for both methods)

    • Weak (one method >80%, the other <70%)

    • Contradictory (conflicting support between methods)

    • Unsupported (<70% for both methods)

The application of MT-ND4 in snake phylogenetics has contributed significantly to understanding evolutionary relationships and taxonomic classification within neglected snake families like Atractaspididae .

What experimental approaches can be used to investigate the function of MT-ND4 in bioenergetics and oxidative phosphorylation?

Investigating MT-ND4 function requires specialized techniques that address its role in mitochondrial bioenergetics:

  • Oxygen consumption measurements:

    • High-resolution respirometry using Oroboros or Seahorse XF analyzers

    • Measurement of Complex I-dependent respiration using NADH-linked substrates

    • Comparison of respiration rates with and without specific Complex I inhibitors

  • Electron transport chain activity assays:

    • Spectrophotometric assays measuring NADH:ubiquinone oxidoreductase activity

    • In-gel activity assays using blue native polyacrylamide gel electrophoresis (BN-PAGE)

    • Kinetic analysis of enzyme activity (Km, Vmax determination)

  • Protein interaction studies:

    • Co-immunoprecipitation with other Complex I subunits

    • Crosslinking studies to identify neighboring subunits

    • Blue native PAGE combined with second dimension SDS-PAGE for complex composition analysis

  • Site-directed mutagenesis approaches:

    • Generation of point mutations in conserved residues

    • Functional assessment of mutants to identify critical amino acids

    • Complementation studies in model systems with MT-ND4 deficiency

These experimental approaches can reveal insights into the functional role of MT-ND4 in electron transport and oxidative phosphorylation, similar to studies performed with NDUFC1, another Complex I component .

How do structural analyses of MT-ND4 from C. rhombeatus compare with other snake species, and what techniques are most appropriate?

Structural comparison of MT-ND4 across snake species requires specialized approaches:

  • Comparative sequence analysis:

    • Multiple sequence alignment of MT-ND4 sequences from diverse snake species

    • Calculation of sequence identity and similarity percentages

    • Identification of conserved functional domains and species-specific variations

    • Analysis of selection pressure using dN/dS ratios

  • Structural prediction methods:

    • Homology modeling based on determined structures of Complex I from model organisms

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations to assess structural stability

    • Protein threading approaches for transmembrane domain prediction

  • Experimental structural determination:

    • Cryo-electron microscopy of purified Complex I containing MT-ND4

    • X-ray crystallography of recombinant protein (challenging for membrane proteins)

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Structure-function relationship studies:

    • Correlation of structural features with functional data

    • Comparison of structures between different snake families (e.g., Viperidae vs. Elapidae)

    • Identification of structural adaptations related to environmental factors

These approaches can reveal evolutionary adaptations in MT-ND4 structure among different snake lineages, potentially relating to metabolic adaptations in diverse snake species .

What are the challenges and solutions in studying mitochondrial proteins from venomous snakes like C. rhombeatus?

Studying mitochondrial proteins from venomous snakes presents unique challenges:

  • Sample acquisition challenges:

    • Limited availability of fresh tissue samples from venomous species

    • Ethical and regulatory restrictions on collection of endangered species

    • Proper handling and safety considerations when working with venomous snakes

    Solutions: Collaboration with herpetological collections, use of archived tissues from museum specimens, development of non-invasive sampling methods

  • Technical challenges in protein isolation:

    • Low protein yield from limited tissue samples

    • Membrane protein solubility issues

    • Potential degradation during extraction processes

    Solutions: Optimized extraction protocols, use of recombinant protein expression systems (mammalian or E. coli), partial protein expression for functional domains

  • Experimental design challenges:

    • Limited species-specific antibodies and reagents

    • Incompatibility with commercial kits designed for model organisms

    • Difficulty in maintaining cell cultures from snake tissues

    Solutions: Development of cross-reactive antibodies, custom reagent production, adaptation of protocols from related species

  • Data interpretation challenges:

    • Limited reference data for snake mitochondrial proteins

    • Evolutionary divergence affecting functional comparisons

    • Potential unique adaptations in snake mitochondrial function

    Solutions: Comparative approaches with multiple species, integration of phylogenetic data, consideration of environmental and physiological adaptations

Studies on snake species like C. rhombeatus are often neglected despite their importance, resulting in significant knowledge gaps that require specialized approaches to address .

How can recombinant MT-ND4 be used to study potential roles in cellular signaling beyond its function in oxidative phosphorylation?

Recent research suggests mitochondrial proteins may have roles beyond their canonical functions in energy production. For MT-ND4, investigation of secondary signaling roles involves:

  • Cell signaling pathway analysis:

    • Examination of potential interactions with cytosolic signaling proteins

    • Assessment of MT-ND4 influence on redox-sensitive signaling pathways

    • Investigation of retrograde signaling from mitochondria to nucleus

    Methodology: Co-immunoprecipitation, proximity ligation assays, cellular fractionation studies

  • Relationship with PI3K/Akt signaling pathway:

    • Similar to NDUFC1 (another Complex I component) which has been shown to affect the PI3K/Akt pathway

    • Analysis of effects on phosphorylation of Akt and downstream effectors

    • Investigation of effects on apoptotic regulators (Bcl-2, Survivin, XIAP)

    Experimental approach: Western blotting for pathway components, use of pathway agonists (e.g., SC79) or inhibitors, gene knockdown studies

  • Potential influence on cell cycle regulation:

    • Analysis of cell cycle distribution using flow cytometry

    • Assessment of expression of cell cycle regulators (e.g., CCND1, CDK6)

    • Synchronization experiments using thymidine block and nocodazole

    Techniques: Propidium iodide staining, BrdU incorporation, immunoblotting for cyclins and CDKs

  • Cell migration and invasion effects:

    • Wound healing assays to assess migration capacity

    • Transwell migration assays

    • Analysis of epithelial-mesenchymal transition markers

    Methods: Real-time cell migration tracking, immunofluorescence for cytoskeletal markers

These approaches can reveal whether MT-ND4, like other mitochondrial proteins such as NDUFC1, has functions beyond oxidative phosphorylation that may influence cellular processes including proliferation, apoptosis, and migration .

What are the methodological considerations for using MT-ND4 as a molecular marker in snake population genetics and conservation?

MT-ND4 serves as a valuable molecular marker for snake population genetics with specific methodological considerations:

  • Sampling strategy optimization:

    • Geographic coverage considerations for capturing population structure

    • Sample size determination for statistical power

    • Non-invasive sampling techniques (shed skin, blood samples) for endangered species

    • Tissue preservation methods to maintain DNA integrity

  • DNA extraction and amplification protocols:

    • Modified extraction protocols for different snake tissue types

    • Design of snake-specific MT-ND4 primers targeting conserved regions

    • PCR optimization for potentially degraded samples from field collections

    • Use of high-fidelity polymerases to minimize amplification errors

  • Data analysis approaches:

    • Haplotype network construction to visualize population structure

    • Calculation of genetic diversity indices (nucleotide diversity, haplotype diversity)

    • Population differentiation statistics (FST, ΦST)

    • Demographic history analysis (mismatch distribution, Tajima's D, Fu's Fs)

  • Conservation applications:

    • Identification of evolutionary significant units (ESUs)

    • Assessment of genetic connectivity between populations

    • Historical population size estimation

    • Determination of conservation priorities based on genetic uniqueness

  • Integration with ecological data:

    • Correlation of genetic patterns with environmental variables

    • Species distribution modeling incorporating genetic data

    • Analysis of dispersal barriers affecting gene flow

    • Assessment of climate change impacts on genetic connectivity

These methodologies can be applied to understudied snake species like C. rhombeatus, addressing knowledge gaps in snake conservation genetics and population structure .

How can complex interactions between MT-ND4 and other mitochondrial and nuclear-encoded proteins be studied?

Investigating the complex interactome of MT-ND4 requires sophisticated methodological approaches:

  • Integrated proteomics approaches:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID) or APEX2 labeling

    • Stable isotope labeling with amino acids in cell culture (SILAC)

    • Cross-linking mass spectrometry (XL-MS) to capture transient interactions

    Analytical workflow: Protein complex isolation → Tryptic digestion → LC-MS/MS → Computational interactome mapping

  • Functional genomics strategies:

    • CRISPR/Cas9-mediated gene editing of MT-ND4 and potential interactors

    • RNAi-mediated knockdown combined with expression profiling

    • Transcriptome analysis under varying metabolic conditions

    • Proteome-wide analysis of expression changes following MT-ND4 perturbation

  • Systems biology integration:

    • Network analysis of protein-protein interactions

    • Pathway enrichment analysis of MT-ND4-associated proteins

    • Integration of transcriptomic and proteomic datasets

    • Identification of hub proteins in the MT-ND4 interaction network

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize protein complexes

    • Fluorescence resonance energy transfer (FRET) to detect protein interactions

    • Live-cell imaging with fluorescently tagged proteins

    • Correlative light and electron microscopy for ultrastructural localization

  • Computational prediction methods:

    • Molecular docking simulations

    • Machine learning approaches for interaction prediction

    • Coevolution analysis to identify interacting partners

    • Integrative modeling combining multiple data types

These sophisticated approaches can uncover the extensive interaction network of MT-ND4, revealing its role within Complex I assembly and potential moonlighting functions in cellular processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.