Recombinant CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA)

Shipped with Ice Packs
In Stock

Description

Biochemical Function and Catalytic Role

Recombinant PgsA retains the native enzyme's ability to perform the reaction:
CDP-diacylglycerol + sn-glycerol 3-phosphateCMP + 3(3-sn-phosphatidyl)-sn-glycerol 1-phosphate\text{CDP-diacylglycerol + sn-glycerol 3-phosphate} \rightleftharpoons \text{CMP + 3(3-sn-phosphatidyl)-sn-glycerol 1-phosphate}
This reaction is the committed step in PG biosynthesis, making PgsA indispensable for bacterial membrane homeostasis . Its activity is magnesium-dependent and occurs within membrane-associated environments .

Expression Systems

  • Escherichia coli: Recombinant PgsA (UniProt: Q1RAM8) is produced in E. coli with >85% purity (SDS-PAGE) and stored in glycerol-containing buffers .

  • Salmonella choleraesuis: A 182-amino-acid recombinant variant (UniProt: Q57N57) is produced for ELISA-based studies .

Functional Insights from Mutagenesis

MutationEffect on ActivityBiological Impact
R118A60% activity lossReduced PG synthesis, daptomycin resistance .
Y181FDisrupted G3P bindingCompromised membrane asymmetry .
K83AImpaired PGP stabilizationAltered lipid bilayer dynamics .

Role in Antimicrobial Resistance

PgsA mutations (e.g., in S. aureus) correlate with resistance to daptomycin, a last-resort antibiotic . These mutations reduce PG and cardiolipin levels, altering membrane fluidity and drug interaction . Structural studies highlight PgsA as a target for novel inhibitors like HSGN-94, which downregulates PgsA and disrupts lipoteichoic acid biosynthesis in methicillin-resistant S. aureus (MRSA) .

Proteomic Studies

Global proteomics reveal PgsA’s regulatory role in:

  • Toxin secretion: Downregulation of Type VII secretion system (T7SS) proteins (e.g., EsaA, EssB) under PgsA inhibition .

  • Membrane stress response: Interactions with RodZ in Bacillus subtilis to maintain membrane integrity under osmotic stress .

Drug Development

  • Crystallography-guided design: High-resolution structures (2.5–3.0 Å) enable virtual screening for PgsA inhibitors .

  • Activity assays: Detergent-solubilized PgsA variants are used to quantify enzymatic inhibition .

Future Directions

  • Mechanistic studies: Elucidate lipid entry/release dynamics through PgsA’s lateral membrane portal .

  • Therapeutic targeting: Develop dual-action inhibitors targeting PgsA and related pathways (e.g., LtaS synthase) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method or location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
pgsA; Bfl415; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; Phosphatidylglycerophosphate synthase; PGP synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Blochmannia floridanus
Target Names
pgsA
Target Protein Sequence
MFKYYGVFNIPMYLTLFRIIMVPCFVAVFYWPIYWSPMLCTLIFFIAAITDWFDGFLARR WNQTSRIGGFLDPIADKIMIITALILISEHFHVWWMTLPISSIIIREILISSLRECIARV DNKNNISVIWLSKVKTFAQMLALIALLCRLNEWTVIMGVISLYTAMLLTLWSMCYYVYSV SSILLQYKLK
Uniprot No.

Target Background

Function
This protein catalyzes the committed step in the biosynthesis of acidic phospholipids.
Database Links

KEGG: bfl:Bfl415

STRING: 203907.Bfl415

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase and what reaction does it catalyze?

CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) is an enzyme that catalyzes the chemical reaction between CDP-diacylglycerol and sn-glycerol 3-phosphate to produce CMP and 3(3-sn-phosphatidyl)-sn-glycerol 1-phosphate . This reaction represents a critical step in the glycerophospholipid metabolism pathway. The enzyme belongs to the family of transferases, specifically those that transfer non-standard substituted phosphate groups. The reaction can be represented as:

CDP-diacylglycerol + sn-glycerol 3-phosphate → CMP + 3(3-sn-phosphatidyl)-sn-glycerol 1-phosphate

The enzyme's activity is essential for the biosynthesis of phospholipids, which are fundamental components of cellular membranes. Understanding this enzyme's structure and function provides insights into membrane biogenesis and cellular metabolism.

What is the significance of the pgsA gene in various organisms?

The pgsA gene encodes the CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase enzyme in various organisms. This gene plays a crucial role in phospholipid biosynthesis across different species, from bacteria to eukaryotes. In bacteria, pgsA is essential for the synthesis of phosphatidylglycerol, a major phospholipid component of bacterial membranes. In eukaryotes, the enzyme participates in the biosynthesis of phospholipids in the endoplasmic reticulum and mitochondria.

The significance of pgsA extends beyond basic membrane formation. Research has shown that alterations in pgsA expression or activity can affect cell growth, division, and response to environmental stresses. In bacterial systems, the pgsA gene is often studied in the context of membrane integrity, antibiotic resistance, and adaptation to environmental changes. The conservation of this enzyme across diverse species highlights its fundamental importance in cellular metabolism.

How is pgsA classified in the enzyme nomenclature system?

Within the enzyme nomenclature system, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase is classified as follows:

Classification LevelDesignationDescription
EC Number2.7.8.5Unique enzyme identifier
Class2Transferases
Subclass2.7Transferring phosphorus-containing groups
Sub-subclass2.7.8Transferases for other substituted phosphate groups
Serial number2.7.8.5Specific to this enzyme

This enzyme belongs to the broader category of transferases (EC 2), specifically those that transfer phosphorus-containing groups (EC 2.7) . Within this subclass, it falls under the category of transferases for miscellaneous substituted phosphate groups (EC 2.7.8) . The enzyme is registered in various databases including IntEnz, BRENDA, ExPASy, KEGG, MetaCyc, and is associated with specific Gene Ontology terms .

What are the optimal conditions for expressing recombinant pgsA in bacterial systems?

When expressing recombinant pgsA in bacterial systems, researchers should consider several key factors to optimize protein yield and activity. The expression system selection is crucial, with E. coli BL21(DE3) being frequently used due to its reduced protease activity and compatibility with T7 promoter-based vectors.

Temperature management is critical during expression. While standard growth occurs at 37°C, protein expression is often optimal at lower temperatures (16-25°C) to reduce inclusion body formation and improve protein folding. Induction protocols typically employ IPTG at concentrations between 0.1-1.0 mM, with lower concentrations and longer induction times (16-24 hours) often yielding better results for membrane-associated proteins like pgsA.

Media selection significantly impacts expression success. For initial screening, researchers should compare rich media (LB, 2×YT) with defined media supplemented with glucose or glycerol. For challenging expression, specialized media formulations containing phospholipid precursors may improve yield and activity. The table below summarizes key experimental parameters:

ParameterRecommended ConditionsNotes
Expression strainE. coli BL21(DE3), C41(DE3), C43(DE3)C41/C43 strains are optimized for membrane proteins
Growth temperature37°C to OD600 0.6-0.8Standard growth phase
Induction temperature18-25°CLower temperatures reduce inclusion body formation
IPTG concentration0.1-0.5 mMLower concentrations often better for membrane proteins
Induction time16-24 hoursExtended time at lower temperatures improves folding
MediaLB, 2×YT, or TB supplemented with 0.5% glucoseGlucose represses basal expression

Following these methodological approaches will help maximize the likelihood of obtaining functionally active recombinant pgsA enzyme for further characterization and experimental applications.

How should researchers design experiments to assess pgsA activity in vitro?

Designing robust experiments to assess pgsA activity in vitro requires careful consideration of assay conditions, substrate preparation, and detection methods. The primary reaction catalyzed by pgsA involves the transfer of a phosphatidyl group from CDP-diacylglycerol to sn-glycerol 3-phosphate, producing CMP and phosphatidylglycerol phosphate.

For accurate activity assessment, researchers should establish assay conditions that reflect the enzyme's physiological environment. A typical reaction buffer contains 50 mM HEPES (pH 7.0-7.5), 50-100 mM NaCl, 10 mM MgCl2, and potentially 0.05-0.1% detergent (such as Triton X-100 or DDM) to stabilize the enzyme. Both substrates must be prepared carefully; CDP-diacylglycerol is hydrophobic and requires solubilization, while sn-glycerol 3-phosphate is water-soluble.

Detection methods for pgsA activity include:

  • Radioisotope labeling: Using 14C or 32P-labeled CDP-diacylglycerol and measuring product formation by scintillation counting after lipid extraction and TLC separation.

  • Coupled enzymatic assays: Monitoring CMP release by coupling to enzymes that use CMP as a substrate and following spectrophotometric changes.

  • HPLC or LC-MS analysis: Directly quantifying substrate consumption and product formation, offering high sensitivity and specificity.

When designing these experiments, it's essential to include appropriate controls:

  • Negative controls (heat-inactivated enzyme)

  • Substrate-limiting conditions to determine kinetic parameters

  • Known inhibitors to validate the assay specificity

The experimental design should include time-course studies to establish linearity of the reaction and enzyme concentration dependence to ensure proper kinetic analysis. Following these methodological guidelines will ensure reliable and reproducible assessment of pgsA activity in vitro.

What experimental approaches can be used to study pgsA regulation at the transcriptional level?

Studying pgsA regulation at the transcriptional level requires a multi-faceted experimental approach combining molecular biology, biochemistry, and genomics techniques. Several methodological strategies can be employed:

Promoter analysis techniques are fundamental for understanding transcriptional regulation. Researchers should clone the pgsA promoter region and its variants into reporter constructs containing luciferase, GFP, or β-galactosidase genes. These constructs can then be used in both in vitro and in vivo systems to measure promoter activity under various conditions, such as different growth phases, nutrient availability, or environmental stresses. Deletion and mutation analysis of the promoter region can identify specific regulatory elements.

Transcription factor identification and characterization is another critical approach. Techniques such as electrophoretic mobility shift assays (EMSA) can identify proteins that bind to the pgsA promoter region. Chromatin immunoprecipitation (ChIP) experiments, followed by sequencing (ChIP-seq) or qPCR, can verify these interactions in vivo and map binding sites with high resolution. Yeast one-hybrid assays provide an alternative method for identifying transcription factors that interact with specific DNA sequences.

For studying transcriptional dynamics, real-time quantitative PCR (RT-qPCR) provides a sensitive method for measuring pgsA mRNA levels under different conditions. RNA-seq offers a broader view, allowing researchers to place pgsA regulation within the context of global transcriptional networks. For more detailed temporal analysis, techniques like nascent RNA sequencing or metabolic RNA labeling can distinguish between transcription rates and mRNA stability effects.

How does site-directed mutagenesis of pgsA affect enzyme catalytic properties?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in the pgsA enzyme. By systematically altering specific amino acid residues, researchers can probe the catalytic mechanism, substrate binding interactions, and structural elements critical for enzyme activity.

Mutations targeting the active site residues typically result in the most dramatic effects on enzyme catalysis. For CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, conserved aspartate and histidine residues often participate directly in the phosphatidyl transfer reaction. Substituting these residues with alanine generally results in substantial loss of catalytic activity, with kcat values reduced by several orders of magnitude while having minimal effects on substrate binding (Km values). In contrast, more conservative substitutions (e.g., aspartate to glutamate) may retain partial activity, providing insights into steric and electronic requirements of the catalytic mechanism.

Mutations in substrate binding regions typically alter enzyme kinetics in more subtle ways. Changes to hydrophobic residues lining the CDP-diacylglycerol binding pocket can shift substrate specificity toward different acyl chain lengths or degrees of saturation. Similarly, alterations to residues interacting with the glycerol-3-phosphate substrate can affect binding orientation and therefore reaction stereospecificity.

The table below summarizes typical effects of different classes of mutations on pgsA enzyme properties:

Mutation RegionExample MutationsTypical Effects on Enzyme Properties
Active site catalytic residuesD→A, H→A, S→ADramatic decrease in kcat, minimal effect on Km
CDP-diacylglycerol binding pocketF→A, W→A, L→AAltered substrate specificity, increased Km for CDP-diacylglycerol
Glycerol-3-phosphate binding siteR→A, K→AIncreased Km for glycerol-3-phosphate, reduced stereospecificity
Allosteric sitesVariousChanged response to regulators, altered cooperativity
Membrane interaction domainsW→A, F→A, L→AReduced membrane association, decreased activity in membrane environment

When designing mutagenesis experiments, researchers should employ multiple analytical techniques to fully characterize the mutant enzymes, including steady-state kinetics, thermostability assays, circular dichroism spectroscopy, and where possible, structural studies. This comprehensive approach will provide deeper insights into the molecular mechanism of pgsA catalysis.

What approaches can resolve contradictions in published data regarding pgsA activity in different organisms?

Resolving contradictions in published data regarding pgsA activity across different organisms requires a systematic and multifaceted approach. Such inconsistencies commonly arise from variations in experimental methodologies, genetic backgrounds, and the physiological context of measurements.

Standardization of experimental conditions is a primary strategy. Researchers should conduct comparative studies using identical assay conditions, substrate preparations, and detection methods across different source organisms. This approach minimizes technical variables that might contribute to apparent contradictions. Defining a reference methodology with standardized buffer compositions, substrate concentrations, and temperature conditions would facilitate direct comparisons.

Cross-validation through multiple independent methodologies strengthens the reliability of findings. When contradictory results are reported, researchers should employ orthogonal techniques to measure the same parameter. For example, if discrepancies exist in pgsA activity measurements, validation via radiometric assays, coupled enzyme assays, and direct product detection by HPLC or mass spectrometry would provide multiple lines of evidence to resolve the contradiction.

Genetic complementation studies offer another powerful approach. By expressing pgsA genes from different organisms in a null mutant background, researchers can directly compare their functional capacity in an identical cellular environment. This controls for differences in genetic background that might influence activity measurements in native systems.

Meta-analysis of published data with careful attention to methodological details can reveal patterns explaining apparent contradictions. Parameters such as strain background, growth conditions, protein purification methods, and assay conditions should be systematically cataloged and analyzed for their impact on reported activity variations.

When implementing these approaches, researchers should maintain rigorous statistical analyses and transparency in reporting both positive and negative results. Through such methodical investigation, apparent contradictions can often be reconciled as context-dependent variations rather than fundamental disagreements about enzyme properties.

How can structural biology techniques be applied to understand pgsA function?

Structural biology techniques provide crucial insights into pgsA enzyme function by revealing the three-dimensional architecture of the protein, substrate binding sites, and conformational changes associated with catalysis. These approaches complement biochemical and genetic studies by providing atomic-level understanding of enzyme mechanism.

X-ray crystallography remains a gold standard for determining protein structures at high resolution. For pgsA, researchers should focus on crystallizing both the apo-enzyme and enzyme-substrate complexes to understand conformational changes upon substrate binding. The use of substrate analogs or catalytically inactive mutants can facilitate the capture of enzyme-substrate complexes. Optimization of crystallization conditions is particularly challenging for membrane-associated enzymes like pgsA and may require:

  • Detergent screening to identify optimal micelle properties

  • Lipidic cubic phase crystallization for membrane proteins

  • Co-crystallization with antibody fragments to increase hydrophilic surface area

Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative, especially for membrane proteins that resist crystallization. This technique can resolve structures without the need for crystals and can potentially capture multiple conformational states. For pgsA research, cryo-EM may be particularly valuable for studying the enzyme in nanodiscs or liposomes, preserving a native-like membrane environment.

Nuclear magnetic resonance (NMR) spectroscopy provides complementary information about protein dynamics and ligand interactions. While determining the complete structure of pgsA by NMR would be challenging due to its size, targeted NMR studies can reveal:

  • Substrate binding dynamics through chemical shift perturbation experiments

  • Conformational changes using selective isotope labeling

  • Local flexibility and domain movements with relaxation experiments

Molecular dynamics simulations extend experimental structural data by modeling the dynamic behavior of pgsA. These computational approaches can predict:

  • Substrate access pathways to the active site

  • Conformational changes during the catalytic cycle

  • Interactions with the membrane environment

The integration of multiple structural biology techniques provides the most comprehensive understanding of pgsA function. Researchers should combine high-resolution static structures from crystallography or cryo-EM with dynamic information from NMR and simulations to develop complete mechanistic models of enzyme function.

What statistical approaches are most appropriate for analyzing pgsA enzyme kinetics data?

Selecting appropriate statistical approaches for analyzing pgsA enzyme kinetics data requires careful consideration of experimental design, data distribution, and the specific kinetic parameters being investigated. Robust statistical analysis ensures reliable interpretation of enzymatic behavior and facilitates comparison across different experimental conditions.

For basic Michaelis-Menten kinetics analysis, non-linear regression is the preferred method for determining Km and Vmax values directly from substrate concentration versus reaction velocity data. Unlike linearization methods (e.g., Lineweaver-Burk plots), non-linear regression gives appropriate weighting to all data points and provides more accurate parameter estimates. The equation used is:

v = (Vmax × [S]) / (Km + [S])

Where v is reaction velocity, [S] is substrate concentration, Vmax is maximum velocity, and Km is the Michaelis constant.

When analyzing more complex kinetic models, such as bi-substrate reactions typical for transferases like pgsA, researchers should apply appropriate rate equations:

For ordered bi-substrate mechanisms:
v = (Vmax × [A] × [B]) / (KiA × KB + KB × [A] + KA × [B] + [A] × [B])

For ping-pong mechanisms:
v = (Vmax × [A] × [B]) / (KmB × [A] + KmA × [B] + [A] × [B])

Where [A] and [B] are substrate concentrations, KmA and KmB are respective Michaelis constants, and KiA is the inhibition constant for substrate A.

Statistical comparison of kinetic parameters should include:

  • Confidence intervals (95%) for each parameter to indicate estimation precision

  • F-test for comparing nested models to determine the most appropriate kinetic mechanism

  • Analysis of residuals to verify model assumptions and detect systematic deviations

For inhibition studies, researchers should use model discrimination techniques to distinguish between competitive, noncompetitive, and uncompetitive inhibition. This involves comparing the goodness-of-fit of different inhibition models using the Akaike Information Criterion (AIC) or similar metrics.

When analyzing temperature and pH effects on pgsA activity, researchers should fit the data to appropriate equations:

  • For temperature effects: the Arrhenius equation or thermodynamic models

  • For pH effects: bell-shaped curves with multiple ionization constants

In all cases, researchers should report not only the best-fit parameters but also their standard errors, the number of replicates, and statistical measures of goodness-of-fit (e.g., R², sum of squares, or residual standard deviation) to enable proper evaluation of the reliability of the results.

How can researchers effectively analyze and interpret pgsA expression data from different experimental systems?

Effective analysis and interpretation of pgsA expression data from different experimental systems requires careful consideration of technical variables, normalization methods, and appropriate statistical approaches. When comparing expression across diverse systems such as bacterial cultures, cell lines, or animal models, researchers must account for system-specific factors that influence gene expression measurement.

For quantitative PCR (qPCR) data, proper normalization is critical. Researchers should select reference genes with demonstrated stability in the specific experimental conditions being tested. The Minimum Information for Publication of Quantitative Real-Time PCR Experiments (MIQE) guidelines recommend using multiple reference genes and validating their stability using algorithms such as geNorm, NormFinder, or BestKeeper. The normalization factor should be calculated as the geometric mean of reference gene expression levels to minimize bias.

When analyzing RNA-sequencing data, appropriate normalization methods include:

  • TPM (Transcripts Per Million) for within-sample comparisons

  • DESeq2 or edgeR normalization for differential expression analysis

  • ERCC spike-in controls for absolute quantification

Statistical analysis of expression data should account for the experimental design, including biological and technical replicates. For simple two-group comparisons, t-tests with appropriate corrections for multiple testing (e.g., Benjamini-Hochberg procedure) may be sufficient. For more complex designs involving multiple factors or time series, researchers should consider ANOVA, linear mixed models, or time series analysis methods.

When interpreting pgsA expression data across different systems, researchers should consider contextual factors including:

  • Differences in genomic context and regulatory elements between species

  • Variation in cellular physiology and metabolic state

  • System-specific responses to experimental interventions

  • Post-transcriptional regulation that may decouple mRNA levels from protein abundance

A comprehensive interpretation approach should integrate expression data with functional assays of enzyme activity, protein abundance measurements, and pathway flux analysis when possible. This multi-level analysis provides a more complete picture of pgsA regulation in different experimental systems and helps resolve apparent contradictions in expression patterns.

For transparent reporting, researchers should present both raw and normalized data, clearly describe all normalization and statistical methods, and acknowledge system-specific limitations that might influence data interpretation.

What approaches are effective for integrating pgsA structural data with functional analyses?

Integrating structural data with functional analyses of pgsA requires methodical approaches that connect atomic-level details to biochemical and cellular observations. This integration creates a comprehensive understanding of how protein structure dictates enzyme function in different contexts.

Structure-guided mutagenesis represents a powerful approach for connecting structural features to function. Based on structural data from X-ray crystallography or cryo-EM, researchers can design targeted mutations of:

  • Predicted catalytic residues to verify their role in the reaction mechanism

  • Substrate binding pocket residues to alter specificity or affinity

  • Allosteric sites to modify regulatory responses

  • Interface residues to affect oligomerization or protein-protein interactions

Functional characterization of these mutants through enzyme kinetics, stability assays, and in vivo complementation studies creates direct links between structural elements and observable functions.

Molecular dynamics (MD) simulations extend static structural data to predict dynamic behavior relevant to enzyme function. These computational approaches can:

  • Model substrate binding pathways and conformational changes

  • Predict effects of mutations on protein stability and dynamics

  • Identify allosteric networks that connect distant regions of the protein

  • Simulate enzyme behavior in membrane environments

Experimental validation of MD predictions through techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or NMR strengthens the connection between computational models and actual enzyme behavior.

Pharmacological approaches using structure-based design of inhibitors or activators provide another avenue for integration. Researchers can:

  • Design compounds targeting specific structural features

  • Test these compounds in biochemical and cellular assays

  • Use the compounds as probes to verify structural hypotheses about enzyme function

The table below illustrates an integrated approach connecting structural features of pgsA with functional observations:

Structural FeatureStructural MethodFunctional ApproachObserved Functional Effect
Active site Asp123X-ray crystallographyD123A mutation, enzyme assays1000-fold reduction in kcat, unchanged Km
Membrane interaction helix (residues 205-225)Cryo-EM in nanodiscsDeletion mutant, subcellular localizationLoss of membrane association, reduced cellular activity
Substrate binding loop (residues 45-52)MD simulationsGlycine insertions, enzyme kineticsIncreased loop flexibility, broader substrate specificity
Allosteric siteHDX-MS with ligand bindingSite-directed mutations, kinetic cooperativityElimination of sigmoidal kinetics, loss of regulation

When implementing these integrated approaches, researchers should maintain clear connections between the specific structural features being investigated and the functional parameters being measured. This clarity facilitates development of mechanistic models that explain how pgsA structure enables its critical role in phospholipid biosynthesis.

What emerging technologies hold the most promise for advancing pgsA research?

Several emerging technologies are poised to significantly advance pgsA research by providing unprecedented insights into enzyme structure, function, and regulation. These innovative approaches span from structural biology to genetic manipulation and computational methods.

Cryo-electron tomography (cryo-ET) represents a revolutionary approach for studying membrane proteins like pgsA in their native environment. Unlike traditional cryo-EM, cryo-ET can visualize proteins directly within cellular membranes, providing insights into:

  • Native oligomeric states and protein-protein interactions

  • Orientation and distribution within membranes

  • Structural changes in response to cellular conditions

This technique avoids potential artifacts introduced by detergent solubilization or reconstitution systems.

CRISPR-based technologies extend beyond simple gene editing to enable sophisticated manipulation of pgsA. CRISPRi/CRISPRa systems allow for precise modulation of pgsA expression without permanent genetic changes, while base editing permits specific amino acid substitutions without double-strand breaks. CRISPR screens can identify genetic interactions and regulatory factors affecting pgsA function. These approaches facilitate:

  • Temporal control of pgsA expression

  • High-throughput mutagenesis for structure-function analysis

  • Identification of synthetic interactions with other metabolic pathways

Single-molecule techniques provide dynamic insights impossible with ensemble measurements. Methods such as single-molecule FRET, force spectroscopy, and nanopore recordings can reveal:

  • Conformational dynamics during catalysis

  • Substrate binding and product release kinetics

  • Rare or transient states in the catalytic cycle

For membrane proteins like pgsA, these techniques may require specialized approaches, such as reconstitution in supported lipid bilayers or nanodiscs.

Artificial intelligence and machine learning approaches are transforming structural biology and enzyme engineering. For pgsA research, these computational methods enable:

  • Improved protein structure prediction using AlphaFold2 or RoseTTAFold

  • Design of pgsA variants with enhanced stability or altered specificity

  • Prediction of enzyme-substrate interactions and catalytic mechanisms

  • Integration of diverse experimental datasets into cohesive models

The synergistic application of these emerging technologies promises to address fundamental questions about pgsA function that have remained elusive with traditional approaches. Researchers should consider interdisciplinary collaborations to fully leverage these advanced methodologies for comprehensive understanding of this critical enzyme in phospholipid metabolism.

How might systems biology approaches enhance our understanding of pgsA's role in cellular metabolism?

Systems biology approaches offer powerful frameworks for understanding pgsA's role beyond isolated enzymatic reactions, placing it within the broader context of cellular metabolism and regulatory networks. These integrative approaches can reveal emergent properties not evident from reductionist studies of the enzyme alone.

Metabolic flux analysis provides quantitative insights into how pgsA activity influences phospholipid metabolism and connected pathways. By using stable isotope labeling (e.g., 13C-glucose or 13C-glycerol) and measuring the distribution of labeled metabolites over time, researchers can:

  • Determine how pgsA flux affects downstream phospholipid compositions

  • Identify rate-limiting steps in phospholipid biosynthesis

  • Quantify compensatory flux changes in response to altered pgsA activity

  • Map connections between phospholipid metabolism and other cellular processes

This approach shifts focus from static measurements of enzyme levels to dynamic understanding of metabolic pathway operation.

Multi-omics integration combining transcriptomics, proteomics, metabolomics, and lipidomics data provides comprehensive views of how pgsA functions within cellular networks. Statistical and computational methods such as weighted gene co-expression network analysis (WGCNA), partial least squares discriminant analysis (PLS-DA), or Bayesian network inference can identify:

  • Co-regulated genes that form functional modules with pgsA

  • Causal relationships between pgsA expression, phospholipid composition, and cellular phenotypes

  • Regulatory hubs that coordinate pgsA expression with metabolic demands

  • System-wide responses to perturbations in pgsA activity

Genome-scale metabolic models (GEMs) enable in silico prediction of how pgsA activity affects global cellular metabolism. These constraint-based models integrate:

  • Stoichiometric relationships between metabolites

  • Enzyme capacity constraints

  • Thermodynamic feasibility

  • Regulatory constraints

By performing flux balance analysis with varying constraints on pgsA activity, researchers can predict cellular adaptations to altered phospholipid metabolism and generate testable hypotheses about metabolic rewiring.

For effective implementation of systems biology approaches, researchers should design experiments with sufficient biological replicates, appropriate time resolution, and controls for confounding variables. Integration of multiple data types requires careful attention to data normalization, missing value handling, and appropriate statistical methods for high-dimensional data. When properly executed, these approaches will transform our understanding of pgsA from an isolated enzyme to a key component of dynamic cellular networks.

What are the most promising therapeutic applications emerging from pgsA research?

While pgsA research has traditionally focused on basic biochemistry and cellular physiology, several promising therapeutic applications are emerging from deeper understanding of this enzyme's structure, function, and regulation. These applications span from antimicrobial development to membrane disorder treatments.

Antimicrobial drug development represents one of the most immediate therapeutic applications. Since pgsA catalyzes a critical step in bacterial phospholipid biosynthesis that differs from mammalian pathways, it presents an attractive target for selective antibiotics. Several factors enhance its potential as an antimicrobial target:

  • Essential nature: Genetic studies have demonstrated that pgsA is essential for viability in many pathogenic bacteria.

  • Structural uniqueness: The bacterial enzyme has structural differences from eukaryotic homologs that can be exploited for selective inhibition.

  • Surface accessibility: As a membrane-associated enzyme, pgsA may be more accessible to inhibitors than cytoplasmic targets.

Current research approaches include structure-based design of competitive inhibitors that mimic the transition state of the phosphatidyl transfer reaction and high-throughput screening of compound libraries against purified enzyme or bacterial growth. Preliminary studies have identified several chemical scaffolds with promising activity against pgsA from pathogenic bacteria.

Membrane disorder therapies represent another emerging application. Alterations in phospholipid composition contribute to various diseases involving membrane dysfunction, including certain neurodegenerative disorders, metabolic diseases, and mitochondrial disorders. Modulating pgsA activity or expression could potentially:

  • Restore proper phospholipid ratios in affected tissues

  • Improve mitochondrial function in disorders with altered membrane composition

  • Enhance cellular resilience to membrane-associated stress

Approaches in development include small molecule modulators of enzyme activity, gene therapy for genetic deficiencies, and lipid replacement strategies that bypass altered synthetic pathways.

Biotechnological applications are also emerging, particularly in the production of customized phospholipids for drug delivery systems, lipidomics standards, and research reagents. Engineered pgsA variants with altered substrate specificity could enable the enzymatic synthesis of novel phospholipids with unique properties for pharmaceutical applications.

While these therapeutic applications show promise, researchers must address several challenges:

  • Developing compounds with appropriate pharmacokinetic properties to reach intracellular targets

  • Ensuring selectivity for bacterial over mammalian enzymes for antimicrobial applications

  • Understanding the complex consequences of altering phospholipid metabolism in eukaryotic cells

  • Establishing appropriate delivery systems for enzyme modulators or replacement therapies

Research efforts addressing these challenges are actively advancing the translation of basic pgsA research into clinical applications.

What are the key unresolved questions in pgsA research?

Despite significant advances in understanding CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA), several key questions remain unresolved, presenting important opportunities for future research. These knowledge gaps span from molecular mechanism to physiological regulation.

The regulatory networks controlling pgsA expression and activity across different organisms represent another significant knowledge gap. While basic transcriptional control has been studied in some model organisms, the complete picture of how cells coordinate pgsA activity with membrane biogenesis, cell division, and response to environmental stresses remains unclear. The potential role of post-translational modifications in regulating enzyme activity is particularly understudied and warrants systematic investigation.

Species-specific differences in pgsA structure and function present both challenges and opportunities for research. The evolutionary adaptations of this enzyme across different domains of life (bacteria, archaea, and eukaryotes) may reveal important insights about membrane phospholipid requirements in different cellular contexts. Comparative studies examining enzyme properties, substrate specificity, and regulatory mechanisms across diverse species would enhance our understanding of both conserved features and adaptive variations.

The role of pgsA in disease states, particularly in bacterial pathogenesis and membrane-associated disorders, remains an emerging area with many open questions. How alterations in enzyme activity contribute to disease progression, and whether these mechanisms can be effectively targeted therapeutically, represents a critical frontier for translational research.

Addressing these unresolved questions will require innovative experimental approaches combining cutting-edge structural techniques, systems biology, and in vivo models. The answers will not only advance our fundamental understanding of phospholipid metabolism but may also open new avenues for therapeutic intervention in various disease states.

What methodological challenges must be overcome to advance pgsA research?

Advancing pgsA research faces several methodological challenges that researchers must overcome to achieve deeper understanding of this important enzyme. These challenges span from protein isolation to functional characterization in complex cellular environments.

Obtaining high-quality purified enzyme presents a fundamental challenge. As a membrane-associated protein, pgsA is inherently difficult to express, solubilize, and purify while maintaining native structure and activity. Current approaches using detergent solubilization often yield preparations with suboptimal activity or stability. Alternative strategies such as nanodiscs, amphipols, or styrene-maleic acid copolymer (SMA) lipid particles offer promising solutions but require extensive optimization. Researchers must systematically evaluate these approaches to identify conditions that balance protein yield with structural integrity and catalytic function.

Structural characterization of pgsA in physiologically relevant states remains technically challenging. While X-ray crystallography has been successful for many enzymes, membrane proteins like pgsA often resist crystallization. Cryo-EM offers an alternative but typically requires larger protein complexes for reliable reconstruction. The dynamic nature of the enzyme during catalysis adds another layer of complexity, requiring methods capable of capturing transient conformational states. Innovative approaches combining multiple techniques, such as integrating hydrogen-deuterium exchange mass spectrometry with computational modeling, may provide insights when traditional structural methods fall short.

Studying pgsA function within its native membrane environment presents methodological difficulties. Traditional in vitro assays with purified components may not accurately reflect the enzyme's behavior in cellular membranes, where local lipid composition, membrane curvature, and interactions with other proteins can significantly influence activity. Developing assay systems that better mimic the native environment, such as proteoliposomes with defined composition or cell-derived membrane fractions, would enhance the physiological relevance of functional studies.

Measuring the impact of pgsA activity on cellular phospholipid composition requires advanced analytical techniques. While lipidomics methods have advanced significantly, challenges remain in:

  • Complete extraction of membrane phospholipids without bias

  • Chromatographic separation of closely related species

  • Unambiguous structural identification

  • Quantification of low-abundance or transient intermediates

  • Spatial resolution of lipid distribution within cellular compartments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.