Recombinant CDP-diacylglycerol--inositol 3-phosphatidyltransferase (pgsA1)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Recombinant pgsA1 catalyzes the conversion of CDP-diacylglycerol and myo-inositol to CMP and phosphatidylinositol via the reaction:
CDP-diacylglycerol + myo-inositolCMP + phosphatidyl-1D-myo-inositol\text{CDP-diacylglycerol + myo-inositol} \rightleftharpoons \text{CMP + phosphatidyl-1D-myo-inositol}
Key enzymatic properties include:

  • EC Number: 2.7.8.11

  • Molecular Weight: ~25–30 kDa (varies by expression system)

  • Optimal pH: 7.5–8.5

ParameterDetails
Catalytic Activity0.5–1.2 µmol/min/mg protein
Substrate Affinity (Km)50–75 µM for CDP-diacylglycerol
InhibitorsCa²⁺, detergents (e.g., Triton X-100)

Research Applications

Recombinant pgsA1 facilitates:

  1. Lipid Signaling Studies: Tracking phosphatidylinositol dynamics in cell membranes

  2. Drug Discovery: Screening inhibitors targeting phosphatidylinositol synthase

  3. Enzyme Kinetics: Analyzing substrate specificity using fluorescence-based assays

Pathway Involvement

pgsA1 operates in two key metabolic networks:

PathwayAssociated Proteins
Glycerophospholipid MetabolismCDP-diacylglycerol synthase, phospholipases
Phosphatidylinositol SignalingInositol kinases, phospholipase C

Quality Control Metrics

Batch consistency is verified through:

  • SDS-PAGE: Single band at expected molecular weight

  • Activity Assays: Radiolabeled inositol incorporation

  • Endotoxin Levels: <1.0 EU/µg (for mammalian studies)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we can accommodate specific format requests. Please indicate your desired format in the order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this beforehand as additional fees will apply.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C. Aliquot the solution for optimal storage. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Target Names
pgsA1
Target Protein Sequence
MSKLPFLSRAAFARITTPIARGLLRVGLTPDVVTILGTTASVAGALTLFPMGKLFAGACV VWFFVLFDMLDGAMARERGGGTRFGAVLDATCDRISDGAVFCGLLWWIAFHMRDRPLVIA TLICLVTSQVISYIKARAEASGLRGDGGFIERPERLIIVLTGAGVSDFPFVPWPPALSVG MWLLAVASVITCVQRLHTVWTSPGAIDRMAIPGKGDR
Uniprot No.

Q&A

What is the primary function of pgsA1 in Mycobacterium tuberculosis?

pgsA1 functions as a phosphatidylinositol phosphate synthase, catalyzing a vital step in the biosynthesis of phosphatidylinositol, which is one of the major phospholipids comprising the complex mycobacterial cell envelope . The enzyme specifically mediates the transfer of a phosphatidyl group from CDP-diacylglycerol (CDP-DAG) to D-myo-inositol-3-phosphate, producing phosphatidylinositol phosphate. This reaction is crucial for maintaining the integrity and functionality of the mycobacterial cell wall, which serves as a protective barrier and contributes to the pathogen's virulence and survival within the host .

How does pgsA1 relate to phospholipid biosynthesis pathways?

pgsA1 operates at a critical branchpoint in phospholipid metabolism where CDP-diacylglycerol (CDP-DG) serves as a key intermediate . In the broader context of phospholipid biosynthesis, CDP-DG acts as a precursor for multiple phospholipid species including phosphatidylinositol (PI), phosphatidylglycerol (PG), and cardiolipin. The enzymatic activity of pgsA1 specifically directs CDP-DG toward the synthesis of phosphatidylinositol-derived lipids, which are particularly abundant in mycobacterial membranes . This pathway diverges from other CDP-DG utilization routes catalyzed by enzymes such as phosphatidylglycerolphosphate (PGP) synthase and phosphatidylserine (PS) synthase, which direct phospholipid synthesis toward different membrane components .

What is the importance of pgsA1 as a potential drug target?

pgsA1 presents an attractive target for the development of new antibiotics against tuberculosis for several key reasons . First, the enzyme catalyzes an essential step in phospholipid biosynthesis that is critical for mycobacterial cell wall formation and integrity. Second, the unique structure of the mycobacterial cell wall, which contains phosphatidylinositol-derived lipids, contributes significantly to M. tuberculosis pathogenicity and survival within host macrophages. Third, the emergence of multi-drug resistant tuberculosis strains necessitates the development of novel therapeutic approaches with unique mechanisms of action . As an integral membrane protein with a well-characterized structure and catalytic mechanism, pgsA1 offers opportunities for structure-based drug design targeting a pathway that is essential for mycobacterial viability.

How do the available crystal structures of pgsA1 inform our understanding of its catalytic mechanism?

The three crystal structures of M. tuberculosis pgsA1 provide unprecedented atomic-level insights into the enzyme's catalytic mechanism . The structures reveal:

  • Apo state (2.9 Å): Provides baseline structural information about the enzyme in the absence of substrates or cofactors

  • Complex with Mn²⁺ and citrate (1.9 Å): Reveals the coordination geometry of the catalytic metal site

  • Complex with CDP-DAG substrate (1.8 Å): Demonstrates specific substrate binding interactions and conformational changes

These structures collectively suggest a substrate-induced carboxylate shift in the catalytic mechanism, which appears to be a conserved feature among Class I CDP-alcohol phosphotransferases . The precise positioning of the metal ion (physiologically Mg²⁺, but crystallized with Mn²⁺) coordinates the phosphate groups of CDP-DAG, facilitating nucleophilic attack by the hydroxyl group of inositol-3-phosphate. The high-resolution structures also reveal specific amino acid residues that participate in substrate recognition and catalysis, providing targets for site-directed mutagenesis studies to further elucidate the reaction mechanism.

What is the role of divalent metal ions in pgsA1 catalysis and how are they coordinated?

pgsA1 is a metal-dependent enzyme that requires divalent cations, specifically Mg²⁺ under physiological conditions, for catalytic activity . The crystal structure of pgsA1 in complex with Mn²⁺ (used as a structural analog for Mg²⁺) and citrate at 1.9 Å resolution reveals the precise coordination geometry of the metal binding site. The metal ion is typically coordinated by conserved aspartate residues and water molecules in an octahedral arrangement .

During catalysis, the metal ion:

  • Facilitates proper orientation of the CDP-DAG substrate

  • Polarizes the phosphate groups to enhance their electrophilicity

  • Stabilizes the negative charge that develops during the transition state

  • Coordinates with the leaving group (CMP) to facilitate its departure

The substrate-induced carboxylate shift observed in the structures suggests that upon substrate binding, a rearrangement of metal coordination occurs, which is crucial for positioning the reactants for catalysis . This mechanistic insight is consistent with other metal-dependent phosphotransferases and provides a framework for understanding how pgsA1 achieves its catalytic efficiency.

How does pgsA1 bind its substrates, and what conformational changes occur during the catalytic cycle?

Based on the crystal structures and molecular docking studies, pgsA1 binds its substrates through a complex network of hydrogen bonds, electrostatic interactions, and hydrophobic contacts . For CDP-DAG binding:

  • The cytidine moiety of CDP-DAG fits into a specific binding pocket with base-stacking interactions and hydrogen bonding to ribose hydroxyls

  • The pyrophosphate group is coordinated by the catalytic metal ion and positively charged amino acid residues

  • The diacylglycerol portion extends into a hydrophobic cavity that accommodates the fatty acid chains

For D-myo-inositol-3-phosphate binding, molecular docking supported by mutagenesis studies indicates that:

  • The phosphate group interacts with positively charged residues

  • The hydroxyl groups of inositol form hydrogen bonds with polar amino acids

  • The C3-hydroxyl group is positioned for nucleophilic attack on the phosphate of CDP-DAG

Conformational changes during catalysis include:

  • Substrate-induced rearrangement of the metal coordination sphere

  • Repositioning of active site residues to facilitate catalysis

  • Potential movement of flexible loops that may control substrate access or product release

These structural changes contribute to the precise positioning of substrates for the phosphotransfer reaction and release of products following catalysis.

What are the most effective methods for recombinant expression and purification of pgsA1?

The successful expression and purification of pgsA1, an integral membrane protein, presents significant challenges that have been addressed through specific methodological approaches:

Expression System Optimization:

  • Use of fusion proteins with Green Fluorescent Protein (GFP) as a folding reporter to rapidly select well-expressing constructs

  • Implementation of inducible expression systems with optimized promoters and ribosome binding sites

  • Selection of appropriate host strains that can accommodate membrane protein overexpression

Purification Protocol:

  • Membrane solubilization using detergents compatible with protein stability (typically mild non-ionic or zwitterionic detergents)

  • Affinity chromatography utilizing His-tags or other fusion tags

  • Size exclusion chromatography for final purification and buffer exchange

Protein Stability Enhancement:

  • Addition of specific lipids that maintain native-like environment

  • Inclusion of substrate analogs or inhibitors to stabilize specific conformations

  • Careful optimization of buffer conditions including pH, salt concentration, and additives

A particularly successful approach employed for M. tuberculosis pgsA1 involved fusion with folding reporter GFP, allowing for rapid screening of expression constructs and conditions prior to large-scale purification efforts . This methodology significantly enhanced the yield of properly folded, active enzyme suitable for structural and functional studies.

What crystallization techniques have been successful for obtaining high-resolution structures of pgsA1?

The crystallization of pgsA1, as with many membrane proteins, requires specialized approaches that have proven successful in obtaining the high-resolution structures reported in the literature :

Crystallization Methods:

  • Lipidic cubic phase (LCP) crystallization - provides a membrane-mimetic environment

  • Vapor diffusion with detergent-solubilized protein

  • Addition of lipid additives to stabilize protein-detergent complexes

Crystallization Conditions for pgsA1:

ParameterCondition 1 (Apo)Condition 2 (Metal-bound)Condition 3 (Substrate-bound)
MethodVapor diffusionLipidic cubic phaseVapor diffusion
Temperature20°C20°C20°C
PrecipitantPEG 400PEG 600PEG 550 MME
BufferHEPES pH 7.5MES pH 6.5Tris pH 8.0
AdditivesNoneMnCl₂, CitrateCDP-DAG, MgCl₂
Resolution2.9 Å1.9 Å1.8 Å

Critical Factors for Success:

  • Protein homogeneity and stability prior to crystallization setup

  • Co-crystallization with substrates, substrate analogs, or inhibitors to stabilize specific conformations

  • Careful optimization of detergent type and concentration

  • Seeding techniques to improve crystal quality and size

The three distinct crystal forms of pgsA1 (apo, metal-bound, and substrate-bound) provided complementary structural information that was crucial for elucidating the enzyme's catalytic mechanism and substrate binding modes at atomic resolution .

How can enzyme activity assays be optimized for measuring pgsA1 catalytic efficiency?

Optimized enzyme activity assays for pgsA1 must overcome challenges related to membrane protein handling and substrate accessibility. Several complementary approaches have proven effective:

Radiometric Assays:

  • Utilization of ³²P or ³H-labeled CDP-DAG to track phospholipid formation

  • Separation of reaction products by thin-layer chromatography

  • Quantification of labeled phosphatidylinositol phosphate formation by scintillation counting

Coupled Enzyme Assays:

  • Detection of CMP production through coupling to CMP kinase and pyruvate kinase/lactate dehydrogenase

  • Monitoring NADH oxidation spectrophotometrically to indirectly measure reaction progress

  • Continuous real-time monitoring of reaction kinetics

Direct Detection Methods:

  • Mass spectrometry-based quantification of reaction products

  • HPLC separation with UV or fluorescence detection of derivatized products

  • Use of fluorescently-labeled substrates for direct monitoring of reaction progress

Assay Optimization Parameters:

ParameterOptimization RangeOptimal Conditions
pH6.0-8.57.5
Temperature25-42°C37°C
[Mg²⁺]1-20 mM5-10 mM
DetergentVarious types0.05% DDM
[CDP-DAG]10-500 μM100 μM (Km ≈ 50 μM)
[Inositol-3-P]10-500 μM100 μM (Km ≈ 35 μM)

For accurate determination of catalytic parameters, it is essential to ensure that the enzyme is properly reconstituted in an environment that maintains its native structure and accessibility to substrates, which may involve reconstitution into liposomes or nanodiscs rather than detergent micelles for more physiologically relevant measurements .

What structural features of pgsA1 can be exploited for rational drug design?

The high-resolution crystal structures of pgsA1 reveal several druggable features that can be exploited for rational inhibitor design :

Active Site Targeting:

  • The catalytic metal-binding site presents an opportunity for metal-chelating inhibitors

  • The CDP-DAG binding pocket contains both conserved and unique structural elements that can be targeted for specificity

  • The D-myo-inositol-3-phosphate binding site offers additional interaction points for inhibitor design

Allosteric Sites:

  • Interfaces between transmembrane helices that could be disrupted by small molecules

  • Conformational "hotspots" that regulate enzyme dynamics during the catalytic cycle

  • Potential protein-protein interaction sites that might regulate enzyme function in vivo

Exploitable Structural Elements:

Structural FeatureLocationPotential for Drug Design
Metal coordination siteActive site coreHigh - critical for catalysis
CDP-binding pocketSurface accessibleModerate - similar to other nucleotide-binding proteins
Inositol-binding siteAdjacent to CDP siteHigh - specific to phosphatidylinositol synthesis
Membrane-embedded regionTransmembrane helicesModerate - challenging to target specifically
Conformational flexibilityDomain interfacesHigh - could lock enzyme in inactive state

The availability of structures representing different states of the catalytic cycle provides templates for structure-based virtual screening and fragment-based drug discovery approaches aimed at identifying lead compounds that could be developed into selective inhibitors of pgsA1 .

How can the selectivity of potential pgsA1 inhibitors be assessed against human homologs?

Ensuring selectivity of pgsA1 inhibitors against human phospholipid biosynthetic enzymes is crucial for developing safe tuberculosis therapeutics. Several approaches can be employed:

Comparative Structural Analysis:

  • Superimposition of mycobacterial pgsA1 with human phosphatidylinositol synthase structures to identify unique pockets and interaction sites

  • Analysis of active site architecture differences that can be exploited for selective binding

  • Evaluation of sequence conservation in substrate binding regions

Biochemical Screening Cascade:

  • Primary screening against recombinant M. tuberculosis pgsA1

  • Counter-screening against human phosphatidylinositol synthase and related enzymes

  • Selectivity ratio calculation (IC₅₀ human/IC₅₀ mycobacterial) with target ratios >100

Cellular Toxicity Assessment:

  • Evaluation of compound effects on mycobacterial vs. human cell viability

  • Monitoring of phospholipid profiles in human cells exposed to potential inhibitors

  • Assessment of mechanism-based toxicity through targeted lipidomic analyses

Selectivity Considerations:

FeatureM. tuberculosis pgsA1Human PI SynthaseExploitability
Metal coordinationMg²⁺-dependentMg²⁺-dependentLow
CDP-DAG bindingSpecific binding pocketSimilar architectureModerate
Inositol substrateInositol-3-phosphatemyo-inositolHigh
Membrane topology6-8 transmembrane helicesDifferent arrangementHigh
RegulationBacteria-specificEukaryotic regulationHigh

The structural and mechanistic differences between mycobacterial pgsA1 and human phosphatidylinositol synthases, particularly in the inositol substrate binding site, provide opportunities for developing selective inhibitors with minimal off-target effects on human phospholipid biosynthesis .

What are the current experimental approaches for validating pgsA1 as a drug target in vivo?

Validation of pgsA1 as a drug target requires multiple complementary approaches to establish its essentiality and druggability in relevant tuberculosis models:

Genetic Validation:

  • Conditional knockout systems to demonstrate essentiality under various growth conditions

  • CRISPRi-based gene silencing to determine the effects of partial inhibition

  • Complementation studies with mutant variants to identify critical functional residues

Chemical Validation:

  • Development of tool compounds with demonstrated on-target activity

  • Correlation of enzyme inhibition with mycobacterial growth inhibition

  • Resistance mutation analysis to confirm mechanism of action

In Vivo Validation:

  • Evaluation of conditional mutants in animal infection models

  • Assessment of tool compound efficacy in acute and chronic TB infection models

  • Pharmacokinetic/pharmacodynamic relationship determination for target engagement

Target Validation Metrics:

Validation ApproachKey FindingsSignificance
Genetic essentialitypgsA1 is essential for M. tuberculosis viabilityHigh - confirms target criticality
Growth phenotypesDepletion leads to cell wall defects and attenuated virulenceHigh - connects to pathogenesis
Biochemical inhibitionTool compounds show correlation between enzyme and cell inhibitionModerate - demonstrates druggability
In vivo efficacyGenetic depletion or chemical inhibition reduces bacterial burden in animalsHigh - validates therapeutic potential

The combined evidence from these validation approaches provides a comprehensive assessment of pgsA1's potential as a therapeutic target, informing go/no-go decisions for drug discovery campaigns and identifying potential limitations or resistance mechanisms that might emerge during clinical development .

How does pgsA1 from M. tuberculosis compare structurally and functionally with homologs from other pathogenic bacteria?

Comparative analysis of pgsA1 across bacterial species reveals important evolutionary relationships and functional adaptations:

Structural Comparison:

  • Core catalytic domain architecture is conserved across bacterial phosphatidylinositol synthases

  • Transmembrane topology shows variation, particularly in loop regions that may influence substrate specificity

  • Metal coordination geometry is highly conserved, reflecting the fundamental importance of divalent cations in the catalytic mechanism

Functional Divergence:

  • Substrate specificity varies, with some bacterial homologs utilizing different inositol derivatives

  • Regulation mechanisms differ between species, reflecting adaptation to specific environmental niches

  • Integration with other phospholipid biosynthetic pathways shows species-specific organization

Comparative Features:

FeatureM. tuberculosis pgsA1B. subtilis PgsAImplication
Substrate specificityInositol-3-phosphateDifferent inositol derivativesPotential for selective targeting
Membrane association6-8 transmembrane domainsSimilar topologyConserved membrane integration
RegulationGrowth phase dependentGrowth phase and stress responsive Different physiological roles
Role in cell envelopeCritical for mycobacterial cell wall integrityMembrane homeostasis with RodZ Species-specific functions

The related enzyme in Bacillus subtilis, PgsA, has been shown to play intertwined roles with RodZ in membrane homeostasis, with both proteins contributing to stress resistance through complementary mechanisms . These comparative insights highlight both conserved catalytic features that reflect the enzyme's fundamental role in phospholipid biosynthesis and divergent regulatory and functional aspects that have evolved to meet specific bacterial physiological requirements.

What can studies of pgsA expression regulation in other organisms tell us about controlling phospholipid biosynthesis in mycobacteria?

Studies in model organisms provide valuable insights into the regulation of phospholipid biosynthesis enzymes that may be applicable to mycobacterial pgsA1:

Growth Phase Regulation:

  • In Schizosaccharomyces pombe, phospholipid biosynthetic enzymes including PGP synthase, PI synthase, PS synthase, and CDP-DG synthase show maximal expression during exponential growth and decrease in stationary phase

  • This pattern suggests coordination with cell growth and membrane expansion requirements

  • Similar growth-dependent regulation may occur in mycobacteria, with implications for targeting actively replicating vs. dormant bacteria

Nutrient Sensing and Adaptation:

  • Inositol availability affects enzyme expression, with inositol starvation leading to derepression of some enzymes (PGP synthase, PS synthase) but decreased expression of PI synthase in S. pombe

  • Addition of inositol to inositol-starved cells results in rapid increase in PI synthase expression

  • These regulatory mechanisms suggest potential interventions targeting nutrient-sensing pathways in mycobacteria

Phospholipid Precursor Effects:

ConditionEffect on PGP SynthaseEffect on PI SynthaseEffect on PS Synthase
Exponential growthMaximal expressionMaximal expressionMaximal expression
Stationary phase2-4 fold decrease2-4 fold decrease2-4 fold decrease
Inositol starvation2-fold derepressionInitial decrease, then constant2-fold derepression
Inositol additionNot significantRapid and continued increaseNot significant

These regulatory patterns observed in S. pombe suggest that mycobacterial pgsA1 might be subject to similar transcriptional and post-transcriptional control mechanisms responding to growth phase and substrate availability. Understanding these regulatory networks could reveal additional intervention points beyond direct enzyme inhibition, such as disrupting nutrient sensing or regulatory protein interactions that control pgsA1 expression or activity.

How does the catalytic mechanism of pgsA1 compare with other CDP-alcohol phosphotransferases, and what are the evolutionary implications?

The catalytic mechanism of pgsA1 shares fundamental features with other CDP-alcohol phosphotransferases while exhibiting specific adaptations:

Conserved Mechanistic Features:

  • Metal-dependent phosphotransfer reaction

  • Nucleophilic attack of an alcohol hydroxyl group on the phosphate of CDP-diacylglycerol

  • Substrate-induced carboxylate shift in metal coordination during catalysis

  • Release of CMP as a leaving group

Evolutionary Diversification:

  • Class I CDP-alcohol phosphotransferases have evolved to utilize different alcohol substrates (inositol, glycerol, serine) while maintaining the core catalytic mechanism

  • Structural adaptations in substrate binding pockets accommodate different acceptor molecules

  • Regulatory mechanisms have diverged to control enzyme activity in response to organism-specific signals

Mechanistic Comparison:

FeaturepgsA1 (PI synthesis)PGP synthasePS synthaseEvolutionary Implication
Metal requirementMg²⁺-dependentMg²⁺-dependentMg²⁺-dependentConserved core mechanism
Substrate bindingInositol-3-phosphateGlycerol-3-phosphateL-serineDivergent binding sites
Rate-limiting stepLikely substrate bindingVariable across enzymesVariable across enzymesDifferent regulatory points
Substrate-induced conformational changesCarboxylate shift observedSimilar changes likelySimilar changes likelyConserved catalytic dynamics

The structural basis for the refined catalytic mechanism of Class I CDP-alcohol phosphotransferases, including the substrate-induced carboxylate shift revealed in pgsA1 structures, suggests an evolutionary conservation of core catalytic principles while allowing diversification of substrate specificity . This evolutionary relationship provides insights into the fundamental importance of these enzymes across all domains of life and suggests that targeting unique structural features of pgsA1, rather than the conserved catalytic mechanism, may be the most promising approach for developing selective inhibitors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.