Recombinant Cebus apella Duffy antigen/chemokine receptor (DARC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ACKR1; DARC; FY; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; CD antigen CD234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Sapajus apella (Brown-capped capuchin) (Cebus apella)
Target Names
Target Protein Sequence
MGNCLHQAELSPSTENSSQLNLEDLWDFPYNGNDSFPEINYDASLEAAAPCYSCNLLDDS SLPFFILASVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPILAPGL GNTRSSALCSLGYCVWYGSAFAQALLLGCHASLGPKLGAGQVPGLTLGLTVGLWGAAALL TVPITLASGASDGLCTPIYSTELKALQATHTVACFAIFVLLPLGLFGAKGVKKALGMGPG PWMTILWIWFIFWWPHGVVLGLDFLVRSKLLLLPTCLAQQVLDLLLNLAEALTIVHCVAT PLLLALFCHQATRTLLPSLPLPERWSSPVDTLGSKS
Uniprot No.

Target Background

Function
Cebus apella Duffy antigen/chemokine receptor (DARC) is an atypical chemokine receptor that regulates chemokine levels and localization. It achieves this through high-affinity chemokine binding, which is uncoupled from traditional ligand-driven signaling cascades. Instead, it leads to chemokine sequestration, degradation, or transcytosis. DARC is also known as an interceptor (internalizing receptor), chemokine-scavenging receptor, or chemokine decoy receptor. It exhibits promiscuous chemokine-binding properties, interacting with inflammatory chemokines from both the CXC and CC subfamilies, but not with homeostatic chemokines. DARC serves as a receptor for various chemokines, including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, and TARC. It potentially regulates chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: When expressed in endothelial cells, it facilitates the transcytosis of tissue-derived chemokines from the abluminal to the luminal side, presenting them to circulating leukocytes. When expressed in erythrocytes, it functions as a blood reservoir for cognate chemokines but also as a chemokine sink, mitigating potential surges in plasma chemokine levels.
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein.

Q&A

What is the Duffy Antigen/Chemokine Receptor (DARC) in Cebus apella?

The Duffy antigen/chemokine receptor (DARC) in Cebus apella (Brown-capped capuchin) is a transmembrane protein that functions as both a chemokine receptor and an erythrocyte receptor for malaria parasites . The protein is also known as CD234 antigen and is encoded by the DARC gene (synonymous with FY) . In Cebus apella, DARC serves as a promiscuous chemokine receptor and is expressed in red blood cells and various other tissues . The protein has a full-length sequence of 336 amino acids and contains conserved extracellular cysteine residues that play important structural roles in the protein's function . Like in other primates, the Cebus apella DARC contains seven transmembrane regions, four cytoplasmic regions, and extracellular binding regions including a specific region that interacts with Plasmodium species .

How does Cebus apella DARC compare with human DARC?

Comparative analysis between Cebus apella and human DARC reveals both similarities and important differences:

  • In the GATA-1 motif region, which is critical for DARC expression in erythrocytes, Cebus apella shows no differences compared to other nonhuman primates . This contrasts with humans from sub-Saharan Africa, who have a nucleotide replacement in this region that inhibits DARC expression on red blood cells, conferring resistance to Plasmodium vivax invasion .

  • At position 42, Cebus apella, like all other nonhuman primates studied, has an aspartic acid residue . This is consistent with the Fyb allele in humans, supporting the hypothesis that Fyb is the ancestral allele of DARC, while the Fya allele (with glycine at position 42) is restricted to humans .

  • Sequence conservation at functionally important sites suggests similar binding properties for chemokines, which indicates that both human and Cebus apella DARC are subject to purifying selection for maintenance of chemokine binding properties .

What are optimal storage and handling conditions for recombinant Cebus apella DARC?

For researchers working with recombinant Cebus apella DARC, proper storage and handling are crucial to maintain protein integrity and functionality:

  • Storage temperature: The protein should be stored at -20°C, and for extended storage, conservation at -20°C or -80°C is recommended .

  • Buffer composition: The optimal storage buffer is a Tris-based buffer with 50% glycerol, specifically optimized for this protein .

  • Handling precautions: Repeated freezing and thawing is not recommended as it may compromise protein structure and function . Working aliquots should be stored at 4°C for no more than one week .

  • Processing considerations: When working with the recombinant protein, researchers should be aware that the tag type will be determined during the production process, which may affect experimental design considerations .

These guidelines ensure maximum stability and activity of the recombinant protein during experimental procedures.

How can recombinant Cebus apella DARC be utilized in comparative malaria resistance studies?

Recombinant Cebus apella DARC offers valuable research opportunities for studying malaria resistance mechanisms:

  • Binding assays: The recombinant protein can be used in vitro to assess binding affinities with various Plasmodium species surface proteins, particularly those from P. vivax and P. knowlesi . The extracellular domain (first 60 amino acids) is particularly important for these studies as it contains the parasite binding region .

  • Cross-species comparisons: Researchers can design comparative binding studies between recombinant DARC proteins from Cebus apella, humans (both Fya and Fyb variants), and other primates to evaluate differences in parasite receptor affinity . These experiments provide insights into the molecular basis of species-specific malaria susceptibility.

  • Structural-functional analysis: Using site-directed mutagenesis of the recombinant protein, researchers can identify critical amino acid residues involved in Plasmodium binding, particularly focusing on differences between Cebus apella and human variants that might explain differences in malaria susceptibility .

  • Inhibition studies: The recombinant protein can be used to develop and test potential inhibitors of Plasmodium-DARC interactions, providing a platform for therapeutic development.

What approaches should be used to study DARC-mediated signaling pathways in Cebus apella?

When investigating DARC-mediated signaling pathways in Cebus apella, researchers should consider these methodological approaches:

  • Receptor expression systems: Recombinant Cebus apella DARC can be expressed in heterologous cell systems (e.g., HEK293 cells) to study signaling in isolation from other cellular components . This approach allows for controlled experiments evaluating specific pathway components.

  • Chemokine binding assays: Using labeled chemokines, researchers can quantify binding affinities and kinetics with recombinant Cebus apella DARC and compare these with human DARC variants . These experiments help establish the functional significance of sequence differences.

  • Calcium flux assays: Although DARC is considered an atypical chemokine receptor that may not signal through traditional G-protein pathways, calcium mobilization assays can still be valuable in assessing potential signaling differences between Cebus apella and human DARC.

  • Co-immunoprecipitation studies: These can identify binding partners of Cebus apella DARC in cellular contexts, helping to map species-specific signaling networks.

  • Phosphorylation analysis: Evaluating post-translational modifications of the receptor and downstream effectors provides insights into signaling cascades activated upon ligand binding.

How does the evolutionary history of DARC in primates inform research with Cebus apella?

Evolutionary analysis of DARC across primates provides important context for Cebus apella DARC research:

  • Selective pressures: DARC is subject to dual selective pressures in primate evolution - internal purifying selection for maintenance of chemokine binding properties and potential external positive selection where parasites act as selective factors . This evolutionary background suggests that Cebus apella DARC may have unique adaptations related to pathogen resistance.

  • Lineage-specific evolution: Maximum likelihood analysis has shown that there are more nonsynonymous than synonymous changes along some branches of the primate phylogenetic tree, especially within the hominoid clade . This indicates potential positive selection acting on specific lineages, which should be considered when using Cebus apella as a model organism.

  • Domain-specific evolution: Different functional domains of DARC show varying evolutionary rates, with the transmembrane regions generally more conserved than extracellular domains . Researchers should consider these domain-specific evolutionary patterns when designing experiments targeting specific regions of Cebus apella DARC.

  • New World monkey divergence: As a New World monkey, Cebus apella's DARC has evolved separately from Old World primates for approximately 35 million years, potentially developing unique functional adaptations that should be accounted for in comparative studies .

What are the implications of Cebus apella as a model organism for DARC-related pathologies?

Cebus apella offers specific advantages as a model organism for studying DARC-related pathologies:

  • Malaria susceptibility models: With a DARC protein structure similar to human DARC but lacking the GATA-1 mutation found in some human populations, Cebus apella provides an excellent model for studying P. vivax invasion mechanisms . This allows researchers to examine malaria susceptibility factors in a controlled experimental setting.

  • Neurological disorder research: Cebus apella has been established as a favored animal model for studying neuroleptic side effects due to its high susceptibility . While this is primarily related to the monkey's DRD3 genotype rather than DARC directly, potential interactions between DARC and dopamine pathways could be explored, especially considering DARC's role in chemokine signaling which may influence neuroinflammation.

  • Inflammatory conditions: As DARC functions as a chemokine receptor involved in inflammatory processes, Cebus apella can serve as a model for studying inflammatory conditions where chemokine dysregulation plays a role.

  • Translational relevance: When using Cebus apella as a model, researchers should carefully consider the genetic differences from humans, including the presence of the ancestral Fyb-type sequence at position 42 . These differences may affect the translation of findings to human contexts.

What approaches can be used to analyze DARC polymorphisms in Cebus apella populations?

To effectively analyze DARC polymorphisms in Cebus apella populations, researchers should implement these methodological approaches:

  • Targeted sequencing: Amplification and sequencing of the entire DARC gene (~3,000 bp), including regulatory regions, coding sequences, and the intron . This comprehensive approach ensures detection of all potential polymorphisms.

  • Population sampling strategy: Collection of samples from diverse geographic regions to capture the full range of genetic diversity within Cebus apella. This should include:

    • Samples from isolated populations

    • Samples from regions with different malaria endemic status

    • Sufficient sample size to detect low-frequency variants

  • Analytical methods: Implementation of multiple analytical approaches:

    • Maximum likelihood tests for selection pressure analysis

    • Comparative analysis between regulatory and coding regions

    • Codon-based tests to identify sites under positive selection

    • Branch-site tests to detect lineage-specific selection

  • Functional validation: Experimental validation of identified polymorphisms using:

    • In vitro expression systems to test for expression differences

    • Binding assays with chemokines and Plasmodium proteins

    • Cell-based assays to assess functional consequences of variants

What are common challenges when working with recombinant Cebus apella DARC and how can they be addressed?

Researchers working with recombinant Cebus apella DARC may encounter several technical challenges:

  • Protein solubility issues: As a transmembrane protein with multiple hydrophobic domains, DARC can present solubility challenges. This can be addressed by:

    • Using detergent-based buffer systems optimized for membrane proteins

    • Expressing only the extracellular domains for certain applications

    • Adding solubility-enhancing tags during recombinant production

  • Proper folding: Ensuring correct folding of the recombinant protein is critical, particularly for the extracellular domains that contain disulfide bonds . Strategies include:

    • Expression in eukaryotic systems rather than bacterial systems

    • Inclusion of chaperones during expression

    • Optimizing oxidizing conditions for proper disulfide bond formation

  • Functional testing: Confirming that the recombinant protein maintains native binding properties through:

    • Chemokine binding assays with known DARC ligands

    • Comparative binding studies with human DARC variants

    • Analysis of glycosylation patterns which may affect function

  • Storage stability: Beyond the basic storage recommendations, researchers should consider:

    • Monitoring protein quality after storage through SDS-PAGE

    • Functional testing before experimental use

    • Addition of protease inhibitors to prevent degradation

How can researchers effectively design comparative studies involving DARC from different primate species?

When designing cross-species studies involving DARC, researchers should implement these methodological approaches:

  • Standardized expression systems: Use consistent expression systems for all species variants to minimize system-specific effects on protein structure and function. This ensures that observed differences are due to sequence variation rather than expression context.

  • Structural considerations: Account for potential structural differences between species by:

    • Performing in silico structural predictions for each variant

    • Conducting circular dichroism spectroscopy to assess secondary structure

    • Using thermal stability assays to evaluate structural robustness

  • Functional equivalence testing: Establish baseline comparisons by:

    • Testing binding affinities with a panel of chemokines conserved across species

    • Evaluating interaction with Plasmodium proteins from different species

    • Assessing signaling capacity in standardized cellular contexts

  • Phylogenetic context: Interpret results within a proper evolutionary framework by:

    • Including species representing key evolutionary divergence points

    • Considering the known selective pressures on DARC evolution

    • Accounting for lineage-specific selection patterns identified through maximum likelihood methods

  • Data analysis and reporting: Implement statistical approaches that:

    • Control for phylogenetic relationships between species

    • Consider both coding and regulatory region differences

    • Account for domain-specific evolutionary rates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.