Recombinant Cell invasion protein sipB (sipB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
sipB; STY3008; t2787; Cell invasion protein SipB; Effector protein SipB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Salmonella typhi
Target Names
sipB
Target Protein Sequence
MVNDASSISRSGYTQNPRLAEAAFEGVRKNTDFLKAADKAFKDVVATKAGDLKAGTKSGE SAINTVGLKPPTDAAREKLSSEGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKE MGIQVSKEFQTALGEAQEATDLYEASIKKTDTAKSVYDAAAKKLTQAQNKLQSLDPADPG YAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNILTKFQGTANAASQN QVSQGEQDNLSNVARLTMLMAMFIEIVGKNTEESLQNDLALFNALQEGRQAEMEKKSAEF QEETRKAEETNRIMGCIGKVLGALLTIVSVVAAVFTGGASLALAAVGLAVMVADEIVKAA TGVSFIQQALNPIMEHVLKPLMELIGKAITKALEGLGVDKKTAEMAGSIVGAIVAAIAMV AVIVVVAVVGKGAAAKLGNALSKMMGETIKKLVPNVLKQLAQNGSKLFTQGMQRITSGLG NVGSKMGLQTNALSKELVGNTLNKVALGMEVTNTAAQSAGGVAEGVFIKNASEALADFML ARFAMDQIQQWLKQSVEIFGENQKVTAELQKAMSSAVQQNADASRFILRQSRA
Uniprot No.

Target Background

Function
SipB is essential for host cell entry via presentation or delivery of SipC to the host cell plasma membrane. It facilitates the transfer of other effector proteins into the host cell, acting in concert with SipC. SipB induces macrophage apoptosis through two mechanisms: a caspase-1-dependent pathway involving caspase-1 activation and subsequent interleukin-1 beta release, and a caspase-1-independent pathway disrupting mitochondria and inducing autophagy. The caspase-1-dependent mechanism relies on its membrane-fusion activity. The SipBC complex, along with its chaperone SicA, is regulated by InvE binding.
Database Links

KEGG: stt:t2787

STRING: 220341.STY3008

Protein Families
Invasin protein B family
Subcellular Location
Secreted. Host cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is SipB and what is its role in Salmonella pathogenesis?

SipB (Salmonella invasion protein B) is a surface protein essential for mammalian cell invasion during Salmonella infection. It functions as a key component in the early stages of infection by enabling non-phagocytic intestinal epithelial cell invasion. During the infection process, SipB localizes to the bacterial cell surface and participates in contact-dependent delivery of bacterial proteins, which subsequently subvert host cell signaling pathways and promote cytoskeletal rearrangements necessary for bacterial uptake through macropinocytosis .

The protein's significance lies in its dual functionality - it acts both as a translocator that forms a pore in the host cell membrane and as an effector protein that can directly interact with host cell components. Researchers investigating bacterial pathogenesis mechanisms should note that SipB's functions cannot be understood in isolation, as it works in concert with other Salmonella invasion proteins (SipA, SipC, SipD) and co-regulated factors such as SopE and SopB to facilitate successful host cell invasion .

  • What are the structural characteristics of SipB protein?

SipB exhibits several notable structural features that contribute to its functional properties:

Structural FeatureCharacteristicsFunctional Significance
N-terminal domainProtease-resistant, predicted to form trimeric coiled coilMediates hexamer assembly, similar to viral envelope proteins
Membrane-interactive domainsHydrophobic regionsEnables integration into both bacterial and host cell membranes
Oligomeric stateForms hexamers in native stateCritical for membrane fusion activity

The protein's structure is particularly noteworthy for its resemblance to viral envelope proteins that direct homotypic membrane fusion. When purified in its native full-length form, SipB assembles into hexameric structures via its N-terminal domain, which is predicted to form a trimeric coiled-coil arrangement. This structural organization is fundamentally important for understanding how SipB integrates into membranes without disrupting bilayer integrity while still facilitating the fusion events necessary for protein translocation .

  • How is recombinant SipB typically expressed and purified?

Recombinant SipB expression and purification involves several methodological considerations:

Expression systems typically rely on recombinant Escherichia coli as the host organism, which allows for controlled expression of the full-length native protein. The expression construct should include appropriate promoter elements and the complete sipB coding sequence derived from Salmonella .

Purification protocols generally involve:

  • Cell lysis under conditions that preserve protein structure

  • Initial separation using affinity chromatography (if tagged constructs are used)

  • Size exclusion chromatography to isolate the hexameric form

  • Verification of purity using SDS-PAGE and Western blotting

When designing expression systems, researchers should consider that membrane proteins like SipB can be challenging to express in soluble form. Optimizing expression conditions (temperature, induction parameters, growth media composition) is often necessary to maximize yield while maintaining proper folding and assembly of the hexameric structure .

  • What experimental approaches are suitable for studying SipB's evolutionary conservation?

Studying SipB's evolutionary conservation requires comparative genomic and structural analyses:

Sequence alignment tools like BLAST, CLUSTAL Omega, or MUSCLE can be used to compare SipB sequences across different Salmonella serovars and related bacterial pathogens. Phylogenetic analyses can reveal evolutionary relationships and conservation patterns of functional domains.

For structural conservation studies, researchers should apply:

  • Homology modeling to predict structures in related species

  • Secondary structure prediction to identify conserved motifs

  • Comparison of hydrophobicity profiles to identify membrane-interacting regions

The evolutionary conservation of SipB's N-terminal domain is particularly relevant as it contains the coiled-coil motif critical for hexamer formation. Analysis of selection pressure on different domains can provide insights into which protein regions are under functional constraints versus those that might be evolving to counter host defense mechanisms .

Advanced Research Questions

  • What experimental approaches can be used to study SipB membrane fusion activity?

Investigating SipB's membrane fusion activity requires specialized techniques:

Experimental ApproachMethodologyData Output
Liposomal fusion assaysPreparation of phospholipid vesicles with fluorescent markers, addition of purified SipB, monitoring of fluorescence changesQuantitative fusion rates under varying conditions (pH, lipid composition)
Membrane integration studiesIncorporation of SipB into artificial membranes, followed by biophysical characterizationMembrane penetration depth, orientation, and structural changes
Heterotypic fusion assaysPreparation of bacterial-derived liposomes containing reporter molecules, co-incubation with mammalian cellsDelivery efficiency of contents into mammalian cell cytosol

Researchers have demonstrated that purified SipB can induce liposomal fusion that is optimal at neutral pH and is influenced by membrane lipid composition. Moreover, SipB can direct heterotypic fusion, facilitating the delivery of contents from E. coli-derived liposomes into living mammalian cell cytosol. This property makes SipB not only a fascinating subject for basic research but also potentially valuable for developing novel delivery systems .

The experimental design should include appropriate controls, such as liposomes without SipB protein and alternative bacterial proteins that are not expected to induce membrane fusion. Time-course experiments are essential to characterize the kinetics of fusion events, and varying protein concentrations can provide insights into the stoichiometry of the fusion process .

  • How does SipB integrate into host cell membranes during infection?

SipB's integration into host cell membranes involves a complex process that can be studied through several complementary approaches:

The protein demonstrates the remarkable ability to integrate into both mammalian cell membranes and phospholipid vesicles without disrupting bilayer integrity. This property is critical for its function in the translocation process. During Salmonella infection, SipB is delivered to the host cell membrane via the type III secretion system (T3SS) needle complex .

Advanced microscopy techniques including super-resolution microscopy and electron microscopy can visualize the localization and organization of SipB within membranes. Researchers should consider using fluorescently tagged SipB variants (ensuring the tag doesn't interfere with function) combined with live-cell imaging to track the dynamics of membrane integration during the infection process.

Biophysical studies using model membrane systems can elucidate:

  • The kinetics of membrane insertion

  • Conformational changes accompanying membrane integration

  • The oligomeric state of membrane-integrated SipB

  • Lipid preferences that might influence targeting to specific membrane domains

Comparative studies of wild-type and mutant SipB proteins can identify specific domains required for effective membrane integration, providing insights into the molecular mechanisms underlying this critical step in pathogenesis .

  • What are the molecular mechanisms behind SipB-mediated membrane fusion?

The molecular mechanisms of SipB-mediated membrane fusion involve several critical steps and structural transitions:

SipB's ability to induce membrane fusion is reminiscent of viral fusion proteins, despite significant differences in primary sequence. The protein's N-terminal coiled-coil domain is thought to undergo conformational changes that bring opposing membranes into close proximity, overcoming electrostatic repulsion and facilitating lipid mixing and fusion pore formation .

Researchers investigating these mechanisms should consider the following experimental approaches:

  • Site-directed mutagenesis to identify fusion-critical residues

  • Hydrogen-deuterium exchange mass spectrometry to detect conformational changes

  • Cryo-electron microscopy to visualize fusion intermediates

  • Computational molecular dynamics simulations to model the fusion process

It's important to note that SipB-mediated fusion is optimal at neutral pH, unlike some viral fusion proteins that require acidification. This suggests a distinct triggering mechanism that warrants further investigation. Additionally, the influence of lipid composition on fusion efficiency indicates specific lipid-protein interactions that may be essential for the fusion process .

  • How does SipB contribute to the type III secretion system functionality?

SipB plays a multifaceted role in the type III secretion system (T3SS) functionality:

As a component of the Salmonella Pathogenicity Island 1 (SPI1), SipB works in concert with other invasion proteins to enable efficient translocation of bacterial effectors into host cells. The protein's dual role as both a translocator and an effector makes it particularly interesting from a functional perspective .

The contribution of SipB to T3SS functionality can be dissected through:

  • Structure-function studies using domain deletion mutants

  • Interaction analyses with other T3SS components

  • Reconstitution experiments using purified components

  • Time-resolved studies of T3SS assembly and activation

Researchers have observed that SipB can fractionate with outer membrane proteins, suggesting an association with the bacterial envelope that may be crucial for its function in the T3SS. The hexameric assembly of SipB may form part of the translocon structure that spans the host cell membrane, creating a conduit for effector delivery .

Understanding the precise mechanisms by which SipB contributes to T3SS functionality requires integrating structural, biochemical, and cellular approaches. Advanced imaging techniques such as cryo-electron tomography can visualize the T3SS in action, potentially revealing SipB's position and conformational changes during the secretion process.

  • What challenges exist in studying SipB interactions with host cell components?

Researchers face several methodological challenges when investigating SipB interactions with host components:

The membrane-associated nature of SipB presents technical difficulties for traditional protein-protein interaction studies. Additionally, SipB's multiple functions and potential conformational changes during infection add complexity to interaction analyses. Specific challenges include:

  • Maintaining proper protein folding and oligomeric state during purification

  • Distinguishing direct interactions from indirect effects mediated by other bacterial factors

  • Capturing transient interactions that may occur during different stages of infection

  • Recreating the appropriate membrane environment for interaction studies

To overcome these challenges, researchers can employ:

Technical ApproachApplication to SipB ResearchAdvantages
Proximity labelingIdentification of host proteins in close proximity to SipB during infectionWorks in native cellular environment
Cross-linking mass spectrometryCapturing transient interactions with host componentsCan identify interaction interfaces
Single-molecule techniquesStudying dynamics of individual SipB-host interactionsReveals heterogeneity in binding modes
Membrane-based pull-down assaysIdentifying lipid and protein interactorsMaintains native membrane environment

When designing single-subject experimental designs (SSEDs) for SipB interaction studies, researchers should ensure their experimental design meets rigorous standards for dependent and independent variables, with proper controls and sufficient data points per experimental phase, as outlined in standard SSED methodologies .

  • How can advanced imaging techniques be applied to visualize SipB during infection?

Advanced imaging approaches offer powerful tools for studying SipB dynamics during infection:

Super-resolution microscopy techniques such as STORM, PALM, and STED can overcome the diffraction limit of conventional microscopy, allowing visualization of SipB localization at nanometer resolution. These techniques are particularly valuable for tracking SipB distribution before, during, and after membrane integration .

For dynamic studies, researchers should consider:

  • Fluorescence recovery after photobleaching (FRAP) to measure SipB mobility in membranes

  • Förster resonance energy transfer (FRET) to detect SipB interactions with host proteins

  • Lattice light-sheet microscopy for long-term, low-phototoxicity imaging of living infected cells

  • Correlative light and electron microscopy (CLEM) to combine functional and ultrastructural information

When designing imaging experiments, careful consideration must be given to fluorescent labeling strategies. Direct fusion of fluorescent proteins may interfere with SipB function, so alternative approaches such as click chemistry with minimally disruptive tags or the use of specific antibodies may be preferable.

For quantitative analysis of SipB distribution and dynamics, researchers should employ appropriate image analysis workflows, including:

  • Segmentation of cellular compartments

  • Single-particle tracking for mobility studies

  • Colocalization analysis with host cell markers

  • Quantification of membrane insertion events over time

These advanced imaging approaches can reveal crucial insights into the spatiotemporal dynamics of SipB during the infection process, complementing biochemical and structural studies to provide a comprehensive understanding of this essential virulence factor .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.