Recombinant Monkeypox virus Cell surface-binding protein (E8L)

Shipped with Ice Packs
In Stock

Description

Overview of E8L Protein

E8L, also known as IMV surface membrane protein, is a 304-amino acid protein with a molecular weight of approximately 32 kDa . It functions as a cell surface-binding protein, specifically interacting with chondroitin sulfate, a glycosaminoglycan, to regulate viral entry . The E8L protein consists of three domains :

  • Virion surface (1-275)

  • Transmembrane (276-294)

  • Intra-virion domain (295-304)

Structure and Function

The E8L protein's ability to bind to cell surface glycosaminoglycans (GAGs) is essential for the mature virus's attachment and pathogenesis . The absence of the E8 protein significantly impairs the virus's ability to bind with GAGs, highlighting its importance as a therapeutic target .

Fantini et al. (2022) identified a ganglioside-binding domain on the MPXV E8L protein, which facilitates the virus's entry through lipid rafts containing negatively charged gangliosides . This domain contains three linear epitopes that overlap with the annular ganglioside-binding motif, with amino acid sequences 43–62, 94–113, and 204–223 . These epitopes are potential immunogens for a specific mpox vaccine formulation .

Role in Vaccine Development

The E8L protein has garnered interest as a target for vaccine development due to its surface exposure and critical role in host cell interaction . A vaccine strategy based on the E8L protein involves identifying binding domains of viral proteins to gangliosides present in lipid rafts of host cells and B epitope predictions .

Fantini et al. demonstrated that the E8L protein possesses a ganglioside-binding motif with several subsites forming a ring structure . The binding of E8L to gangliosides is driven by shape and electrostatic surface potential complementarities . The study suggests using three sequences derived from the E8L protein as immunogens in a vaccine formulation (recombinant protein, synthetic peptides, or genetically based) specific for MPXV .

Therapeutic Potential

Given the lack of specific therapeutics for MPXV, computational studies have explored potential inhibitors targeting the E8 protein . These investigations involve docking commercial drugs and plant-derived compounds against the E8 envelope protein .

In silico drug discovery approaches have identified potential therapeutic agents that may bind to the E8 protein, disrupting its function and inhibiting viral entry . For instance, maraviroc and punicalagin have shown promising binding affinities to the E8 protein, with punicalagin exhibiting higher binding affinity and stability .

Table 1: Potential Drugs Binding to E8L Protein

Drug NameTarget Protein
BrinzolamideE8L
DorzolamideE8L
MethazolamideE8L
MaravirocE8
PunicalaginE8

Expression and Localization

When expressed in 293T cells, the E8L antigen localizes to the endomembrane, suggesting its involvement in intracellular processes during viral infection .

Limitations and Future Directions

While computational and in vitro studies provide valuable insights into the E8L protein's function and therapeutic potential, further in vivo studies are essential to validate these findings and assess the efficacy and safety of potential therapeutic candidates .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
E8L; Cell surface-binding protein; Carbonic anhydrase homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Monkeypox virus
Target Names
E8L
Target Protein Sequence
MPQQLSPINIETKKAISDTRLKTLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNE YVLSTIHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGIIIIAIF LQVSDHKNVYFQKIVNQLDSIRSANMSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADA AWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRA ATTSPVRENYFMKWLSDLREACFSYYQKYIEGNKTFAIIAIVFVFILTAILFLMSQRYSR EKQN
Uniprot No.

Target Background

Function
This protein binds to chondroitin sulfate on the cell surface, mediating virion attachment to the target cell.
Database Links

KEGG: vg:929017

Protein Families
Alpha-carbonic anhydrase family
Subcellular Location
Virion membrane.

Q&A

What is the structural composition of the Monkeypox virus E8L protein?

The E8L protein of Monkeypox virus (strain Zaire-96-I-16) consists of 304 amino acids organized into three topological domains: virion surface (residues 1-275), transmembrane (residues 276-294), and intra-virion (residues 295-304). The protein possesses a distinctive annular ganglioside-binding motif comprised of several subsites that form a ring structure. The 3D structure of E8L can be predicted using servers like Robetta, revealing its complex secondary and tertiary structure arrangements .

The protein's molecular weight is approximately 32 kDa, though due to extensive glycosylation, it typically migrates as a ~40 kDa protein on SDS-PAGE under reducing conditions. This glycosylation is crucial for the protein's functional properties and interactions with host cell components .

How does the E8L protein facilitate viral entry into host cells?

E8L functions as a critical surface binding protein that mediates Monkeypox virus (MPXV) attachment to host cells through two primary binding mechanisms:

  • Chondroitin sulfate interaction: E8L binds specifically to chondroitin sulfate present on the host cell surface, enabling virion attachment to target cells during viral invasion .

  • Ganglioside binding: The protein contains a specialized ganglioside-binding motif that interacts with gangliosides (particularly GM1) present in lipid rafts of host cell membranes. This binding is driven by both shape complementarity and electrostatic surface potential matching between the protein and the ganglioside clusters .

During the binding process, E8L undergoes an induced-fit mechanism that unmasks selected amino acid side chains of its binding motif without significantly altering the protein's secondary structure. This conformational adaptation enhances binding efficiency and specificity. Inhibiting this interaction through approaches such as small interference RNA (siRNA) has been shown to reduce MPXV transmission and replication by up to 95% at 200 nM concentrations .

Why is E8L considered a promising target for monkeypox vaccine development?

E8L presents multiple characteristics that make it an ideal vaccine target:

  • Surface accessibility: As a virion surface protein, E8L is readily accessible to neutralizing antibodies, increasing the likelihood of successful immune targeting .

  • Functional significance: E8L plays an essential role in viral entry, making it a critical vulnerability point where antibody neutralization can prevent infection .

  • Epitope characteristics: The protein contains three potential linear B epitopes (residues 43-62, 94-113, and 204-223) that overlap with its ganglioside-binding motif. These epitopes are well-exposed on the unbound E8L surface that faces the host cell membrane, creating an ideal situation for generating neutralizing antibodies .

  • Human-foreign pentapeptides: The E8L subunit contains human-foreign pentapeptides that may serve as viable epitopes for MPXV vaccinations, enhancing immunogenicity while minimizing cross-reactivity with human proteins .

Research has demonstrated that targeting these specific regions can effectively neutralize the virus without the risk of antibody-dependent enhancement of infection (ADE), a significant safety advantage over some other vaccine approaches .

What are the recommended approaches for developing E8L-based vaccines against Monkeypox?

Based on current research, several methodological approaches for E8L-based vaccine development have been proposed:

  • Recombinant protein vaccines: Using the extra-viral domain (residues 1-245) of E8L as an immunogen. This approach preserves the protein's native conformation while eliminating potentially problematic transmembrane and intra-virion regions .

  • Synthetic peptide vaccines: Employing individual linear epitopes (43-62, 94-113, and 204-223) or portions thereof as immunogens. These peptides can be used alone or in strategic combinations, though careful selection is required as some epitopes (43-62 and 94-113) significantly overlap in the 3D structure and should not be combined in the same formulation .

  • Genetic vaccines: Developing mRNA or DNA vaccines coding for the E8L protein (preferably the 1-245 domain), delivered through lipid nanoparticles or other appropriate vectors .

When designing combination approaches, researchers should note that while epitope 204-223 can be mixed with either 43-62 or 94-113, combining 43-62 and 94-113 may not be optimal due to their structural overlap .

What expression systems are most effective for producing recombinant E8L protein?

Several expression systems have been successfully employed for recombinant E8L production, each with distinct advantages:

  • Human embryonic kidney (HEK293) cells: This mammalian expression system produces E8L with a C-terminal His-tag, yielding protein with native-like glycosylation patterns. The expressed region typically spans Met1-Thr275, and the resulting protein shows >95% purity when analyzed by SDS-PAGE under reducing conditions .

  • Yeast expression systems: These provide protein structures closer to native conformation compared to bacterial systems, with appropriate post-translational modifications. The purity of these recombinant proteins typically exceeds 85% as measured by SDS-PAGE .

  • Multiple expression system approach: For comprehensive research, using E8L expressed in different systems allows comparative studies of structural and functional properties.

For optimal results, expressed proteins should undergo quality control including purity assessment (SDS-PAGE), deglycosylation analysis, and endotoxin level testing (<0.5 EU per μg protein as determined by LAL method) .

Typical formulation involves lyophilization from a 0.2 μm filtered solution in PBS (pH 7.4) with 1% mannitol and 5% trehalose, with recommended reconstitution at 0.5-1 mg/mL with sterile deionized water .

What methodologies are recommended for studying E8L interactions with host cell receptors?

To investigate E8L interactions with host cell receptors, researchers should consider these methodological approaches:

  • Molecular docking studies: Computational investigations have successfully identified potential inhibitors of E8L by modeling interactions with various ligands. For example, studies have shown that plant-derived compounds like punicalagin exhibit higher binding affinity (-9.1 kcal/mol) to E8L than commercial drugs like maraviroc (-7.8 kcal/mol) .

  • Molecular dynamics (MD) simulations: 100 ns MD simulations can validate the stability of E8L-ligand complexes by measuring parameters such as root-mean-square deviation (RMSD), root-mean-square fluctuation (RMSF), and radius of gyration (Rg) .

  • Ganglioside binding assays: Since E8L interacts with gangliosides (particularly GM1) in lipid rafts, experimental setups using artificial lipid raft domains with clustered gangliosides can help evaluate binding kinetics and specificity .

  • RNA interference studies: siRNA targeting E8L has demonstrated efficacy in reducing viral transmission and replication. Dose-dependent studies have shown 78% reduction with 100 nM siRNA treatment and 95% reduction with 200 nM treatment, providing a methodological framework for similar inhibition studies .

How do genomic variations in the E8L gene affect protein function across different Monkeypox virus strains?

Monkeypox virus has undergone recent genomic changes, including insertions and deletions in conserved regions common across orthopoxviruses and MPXV-specific sections. These genetic alterations affect the functionality of critical genes related to immune modulation and viral replication, contributing to the virus's genetic diversity and potentially its host range .

For E8L specifically, researchers should investigate:

  • Sequence variations: Comparing E8L sequences across different MPXV isolates (particularly between Clade I, formerly Congo Basin clade, and Clade II, formerly West African clade) to identify conserved and variable regions.

  • Structure-function relationships: Analyzing how amino acid substitutions affect the ganglioside-binding motif and the three identified B-cell epitopes (43-62, 94-113, and 204-223).

  • Host range implications: Determining whether E8L variations correlate with changes in host specificity or tissue tropism, as adaptations could enable the virus to infect new hosts or thrive in different ecological conditions.

  • Vaccine efficacy considerations: Assessing whether existing vaccine candidates targeting E8L maintain efficacy against emerging variants, particularly those from the 2022-2024 outbreaks.

This research is critical given the WHO's declaration of a global health emergency on August 14, 2024, due to the recent mpox outbreak, highlighting the need for vigilant monitoring of viral evolution that might impact vaccine effectiveness .

What role does the E8L protein play in viral immune evasion strategies?

While E8L's primary function involves viral attachment to host cells, advanced research should investigate its potential contributions to immune evasion:

  • Epitope shielding dynamics: Investigating whether the conformational changes that occur during E8L binding to gangliosides or chondroitin sulfate might shield certain epitopes from antibody recognition.

  • Host immune signaling interference: Examining if E8L interactions with host cell receptors modulate intracellular signaling pathways involved in innate immune responses.

  • Antibody-dependent enhancement risk assessment: Though current research suggests E8L-based vaccines carry low risk of antibody-dependent enhancement, rigorous experimental validation is needed across diverse conditions and host genetic backgrounds.

  • Cross-reactivity with human proteins: While E8L contains human-foreign pentapeptides suitable for vaccines, comprehensive analysis of potential cross-reactivity with human proteins is essential for safety assessment.

Understanding these aspects will contribute to more effective vaccine design strategies and potentially reveal new therapeutic targets for treatment development .

What are the main difficulties in producing stable, functionally active recombinant E8L protein?

Researchers face several challenges when producing recombinant E8L protein:

  • Glycosylation heterogeneity: E8L undergoes extensive glycosylation that affects its apparent molecular weight (migrating as ~40 kDa despite a calculated mass of ~32 kDa). Maintaining consistent glycosylation patterns across production batches requires stringent quality control protocols .

  • Structural integrity maintenance: Preserving the ganglioside-binding motif's annular structure is crucial for functionality. Expression conditions must be optimized to ensure proper protein folding.

  • Stability considerations: As a lyophilized product, recombinant E8L requires specific formulation (typically in PBS with 1% mannitol and 5% trehalose) and reconstitution protocols to maintain stability and activity .

Solutions include:

  • Using mammalian expression systems (particularly HEK293 cells) that provide appropriate post-translational modifications

  • Implementing rigorous purification procedures to achieve >95% purity

  • Conducting deglycosylation analysis to characterize glycosylation patterns

  • Storing at -20°C and reconstituting with sterile deionized water at recommended concentrations (0.5-1 mg/mL)

How can researchers effectively measure neutralizing antibody responses against E8L protein?

Developing robust assays to measure neutralizing antibody responses against E8L is critical for vaccine development. Recommended methodological approaches include:

  • Pseudovirus neutralization assays: Creating pseudotyped viruses expressing E8L on their surface to safely assess neutralizing antibody efficacy without requiring BSL-3 facilities needed for live MPXV.

  • Epitope-specific ELISA: Developing enzyme-linked immunosorbent assays using synthetic peptides corresponding to the three identified B-cell epitopes (43-62, 94-113, and 204-223) to quantify epitope-specific antibody responses.

  • Competition binding assays: Measuring the ability of antibodies to prevent E8L binding to gangliosides or chondroitin sulfate, providing functional assessment of neutralization potential.

  • Cell-based entry inhibition assays: Quantifying how effectively antibodies block the entry of E8L-expressing viruses or virus-like particles into target cells.

These methodologies should be validated using sera from vaccinated animals and, when available, from human vaccine trials to establish correlates of protection that can guide vaccine development and evaluation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.